CAZyme Information: PWY71724.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY71724.1
• CAZy Family: AA7
• CAZyme Description: CBM21 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A317VBJ7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693		76319.51	9.8626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000027:346024-348105(-)

Full Sequence      

MPYTAPLKTSPFAQHIEHSELTPQSCPSSPTAVTSPPPRQHLPRSYSSTSYVRRHRRSPS
NSKVFVFPSSDSHSKVDHAIDTHASIRSSPPPLSDAVIPPGALISPPESAPNSSDEELSY
RSQDGLQLEKLEAAVRSIEQRRVSSPERHPLDMQPSSSMAAISGGPVRPPHPPLSREARK
ISHSRSATETSIDAKHEEALTSSPEESDRDDEPRAKHPMVRKKSGELVRPALRPSSSRRR
PSSMPGTPTFSKAVHFDAQLEHIRHFLQLDRPQAVSADTSPVEDYNAAGEFPFSKKSHGQ
TSTVWELSLTNFPSDIASRATQRVRLERLYLSSDKNTMIGVVGVANLAYHKHVAARFTLD
HWKTVSEVSAEFSDAGRRKLSDDGYDRFSFNIKLDDQTNLEKKTMFVCVRYNVGGQEYWD
NNNSQNYQVNFIKTTKMKPEAPAPPPAKPRASLPRSRSFAGSNNRPHSMPPSFDTFSEMD
NYTSFGSPPKNAKVKPLADDDPNDVETVAPIRRDKQGHQVFGNRYDFEASLSAAMQTKQA
HDRTTLTARAKSHAPSRGHHGQTPDKRTSPKTENAPSVSKASPQTTPFNHHKPSTLVSSK
PHRESSVYKELVDKYCFFGSTNFSAGPDGPATATRDFGSRSGSSSSSSSVSPCSSPRMSP
RAEAAPSSPNHTGYQYIQNSFLNETKTPAIIQG

Enzyme Prediction     

No EC number prediction in PWY71724.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	322	429	1.4e-33	0.9719626168224299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	2.61e-53	319	430	2	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	2.09e-10	346	429	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS08756.1|CBM21	0.0	1	693	1	705
BCR96239.1|CBM21	0.0	1	693	1	705
UDD62044.1|CBM21	2.27e-267	1	693	1	700
QMW42372.1|CBM21	9.15e-267	1	693	1	700
BAE59674.1|CBM21	9.15e-267	1	693	1	700

PDB Hits     

PWY71724.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UQK1|PPR3C_HUMAN	4.66e-11	332	485	163	316	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
sp|Q7TMB3|PPR3C_MOUSE	1.12e-10	294	485	125	316	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q5U2R5|PPR3C_RAT	3.57e-10	294	433	125	260	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
sp|Q0VCR4|PPR3C_BOVIN	2.05e-09	332	485	163	317	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1
sp|P28006|GAC1_YEAST	1.34e-08	322	436	241	365	Serine/threonine-protein phosphatase 1 regulatory subunit GAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAC1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PWY71724.1.