CAZyme Information: PWY69733.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY69733.1
• CAZy Family: AA7
• CAZyme Description: glycosyl hydrolase family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454		49729.41	4.1267

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000032:152325-154034(+)

Full Sequence      

MRLFRDFLYGGLFLNTALFSQLARAIDLDINSSVKDAASKTAYGSMTWYHGNETGQIPGA
FPTKWWEGSALFMSLLLYWYYTGDSTYNAEVRQGMQWQAGDCDYMPANYSSYLGNDDQMF
WGLAAMTAAEIEFADSSDGYSWLALAQGVYNTQVDRWDSSTCGGGLRWQIWPYEAGYEMK
NSISNGGLFQLAARLARYTSNDTYADWAEKIWDWCTSTPLLNNETWNVADSTDISNGCTT
QGDNQWSYNYGTFLMGAAYMYNYTKEAKWKSAVDGLLNKTLDTFFPTTYGGNIMSEILCE
PAEVCNDNEILFKGLVTGWLGFVALVVPATYDTILPKLQGSAVAAAASCSGMTNNTCGVR
WYPEKWDGWNGMEEEIAVTNVLASSLINTKKTAPVTSSTGGNSTSDPNAGTNDNTGSSTT
SSKITTGDKAGASILTIAFVGMWGGMIAWMLIGG

Enzyme Prediction     

No EC number prediction in PWY69733.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	28	396	1.7e-100	0.9692737430167597

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.02e-167	33	378	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	0.007	138	268	93	229	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46589.1|GH76	4.31e-297	1	454	1	457
BCS11652.1|GH76	2.77e-293	1	454	1	457
BCR99351.1|GH76	2.77e-293	1	454	1	457
BAE65580.1|GH76	2.57e-240	1	453	1	455
UDD65266.1|GH76	2.99e-239	21	453	20	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.26e-94	28	410	30	425	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	2.83e-105	26	436	24	433	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q5AD78|DCW1_CANAL	1.75e-104	11	452	4	452	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	1.16e-103	17	442	12	435	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	2.05e-103	14	410	9	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	6.72e-98	17	452	13	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000712	0.999269	CS pos: 25-26. Pr: 0.9652

TMHMM  Annotations     

Start	End
430	452