CAZyme Information: PWY69359.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY69359.1
• CAZy Family: GH13|GH13
• CAZyme Description: xyloglucan-specific endo-beta-1,4-glucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248		27094.88	3.5606

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000018:421292-422092(-)

Full Sequence      

MNRYLSIPLCLASAVPALAGLAARDPIATICTQNNIITTDDFILYNNLWGEDYATSGSEC
TYLDYDSGNSISWQTSWTWAGGDDYVKSYPNAVLNVGAKQLSTITTIPSTWKWSYTGDDL
VADVSYDAFLATTDSTTATHEYEIMIWLAAYGGIEPIGNSDGPIASPTIGGYTWDLYEGP
NDWTVYSFVARETITDFSADLMEFFTYLVDNEGVSTSLYLQTLGAGTEPKTGSDAWFTVA
PYTISINT

Enzyme Prediction     

EC	3.2.1.4:15	3.2.1.151:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	99	246	4.1e-42	0.9807692307692307

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	4.96e-49	46	247	7	207	Glycosyl hydrolase family 12.
235746	PRK06215	2.57e-15	5	189	15	180	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12351.1|GH12	1.11e-183	1	248	1	248
BCS00584.1|GH12	1.11e-183	1	248	1	248
CAG17892.1|GH12	1.77e-180	1	248	1	248
CAK38314.1|GH12	1.77e-180	1	248	1	248
CAK36874.1|GH12	1.14e-91	13	246	7	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VL8_A	2.22e-82	20	246	4	228	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
3VLB_B	5.03e-82	31	246	8	221	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
4NPR_A	1.42e-76	31	246	28	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
6K9D_A	2.26e-59	29	247	2	218	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]
6K98_A	5.31e-58	29	247	3	219	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2Q877|XGEA_ASPNC	2.02e-92	13	246	7	240	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=xgeA PE=3 SV=1
sp|A1XP58|XGEA_ASPNG	1.16e-91	13	246	7	240	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger OX=5061 GN=xgeA PE=1 SV=1
sp|O94218|XGEA_ASPAC	7.65e-82	18	246	11	237	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus aculeatus OX=5053 GN=xgeA PE=1 SV=1
sp|Q2UK93|XGEA_ASPOR	3.30e-81	8	246	6	239	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xgeA PE=3 SV=1
sp|B8N3L3|XGEA_ASPFN	3.30e-81	8	246	6	239	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xgeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999735	CS pos: 24-25. Pr: 0.8892

TMHMM  Annotations     

There is no transmembrane helices in PWY69359.1.