CAZyme Information: PWY68912.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY68912.1
• CAZy Family: GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453		51617.35	6.2552

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000019:652289-654264(-)

Full Sequence      

RIRVMNVFGNGASVDVTLRYLGGLFYDNPQTTLSPDHCTEIQNLCQIALMILQSSPRGSC
LQWLTSQFNRRRFQLSFALAIVLLLSYLFHLDVLPTDYEAPFKDHYARTLSARDLLARPL
SQDLTTIPKLIHQTWFPAGSNMSDDAQTWVRTMRSQNADWEYVLWDDETNRMLVEQYFPW
FLTDYNRLPKEIHRADVVRNLYMYLFGGMYADVDTEALRPVEPLFTSHSTTLAKHSQILS
SGPRKNDHDCTQRGFVGHMAHKEGLDGPAAVPNGWMASPPGHPFWLLPVIHVIENPNGNG
DGSVESLTGPGALGTMLHKYYEDFEDSSVRTHVCRTVRRWSPAWDLYCGPEGSEDEVGAK
ADKMVVLPRQQIYPYSWADDKHPACLAAWGNPDFNPDELQLKDAHSQNGTVTLFRALIGQ
WGQCPQASALLDYYYTTTRLVYRIQLEHLPSFR

Enzyme Prediction     

No EC number prediction in PWY68912.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	147	225	5e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.80e-21	125	330	80	249	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.36e-14	143	224	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10897.1|GT32	9.61e-268	50	398	1	349
BCR98563.1|GT32	9.61e-268	50	398	1	349
CAK38227.1|GT32	1.84e-196	142	398	1	257
QRD92713.1|GT32	4.33e-141	69	398	11	340
QMW36295.1|GT32	4.33e-141	69	398	11	340

PDB Hits     

PWY68912.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	2.12e-18	121	224	51	152	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.49e-14	101	320	59	243	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.20e-13	123	297	60	203	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q5A4E3|OCH1_CANAL	8.19e-08	128	383	100	381	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

Start	End
75	94