CAZyme Information: PWY68261.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY68261.1
• CAZy Family: GH11
• CAZyme Description: exo-polygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440		47822.14	4.7868

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000020:332782-334104(+)

Full Sequence      

MSVFKASLLFLLSSSLVHGIPHSSRASRSQQCVVPSKYQASNGTADDSSAISQAFAQCAT
DSVIIFEKGVNYNVFQPITATNLSNVEIRMHGNLHLPQNITAVQNIVSDGSSTWFTLEGP
KVDWIGPEDVNNGWIDSYGQPWWDANPAGSSGIDNRPHLMSFKTSQATIKYFRSRKPIAW
NVKLHGQDITVSHAIIDATSTGSFPFNTDGFDVEGTNIQITDSIMYNGDDAIAVGADSHD
ILFTRNTIGYQTHGMSIGSLGEDPTDFANISNIRFDDVTVADGLYAARFKSWSGGTGLVK
NVTWNNIRVFNVTFPIYVTQSYTDQGASRSGTVNASSAVMMEDFTWSDFSGSINTYQPGD
GSCISDPCWYNVGLPNLKHTEALIIECHTSQSCKNFVTDNIQLYPQVLEPASVICMNATA
ALNPDLGFTCKNGTYSPIST

Enzyme Prediction     

EC	3.2.1.67:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	56	420	7.8e-49	0.9661538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	3.95e-30	124	396	47	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	3.25e-26	42	417	57	388	polygalacturonase
177865	PLN02218	4.32e-23	17	352	51	381	polygalacturonase ADPG
215426	PLN02793	7.84e-20	189	433	211	428	Probable polygalacturonase
178580	PLN03003	1.02e-18	42	368	34	347	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS06604.1|GH28	0.0	1	440	1	440
BCR93993.1|GH28	0.0	1	440	1	440
ABD14402.1|GH28	0.0	1	439	1	439
ABD61565.1|GH28|3.2.1.67	0.0	1	439	1	439
CAK44512.1|GH28|3.2.1.67	3.13e-277	1	439	1	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CZF_A	1.96e-17	79	396	46	356	Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger],1CZF_B Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger]
1HG8_A	4.87e-15	135	363	81	321	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
1K5C_A	2.54e-14	115	324	61	264	Endopolygalacturonase I from Stereum purpureum at 0.96 A resolution [Chondrostereum purpureum],1KCC_A Endopolygalacturonase I from Stereum purpureum complexed with a galacturonate at 1.00 A resolution. [Chondrostereum purpureum],1KCD_A Endopolygalacturonase I from Stereum purpureum complexed with two galacturonate at 1.15 A resolution. [Chondrostereum purpureum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q27UB0|PGXC_ASPNG	0.0	1	439	1	439	Exopolygalacturonase C OS=Aspergillus niger OX=5061 GN=pgxC PE=2 SV=1
sp|A2QEW2|PGXC_ASPNC	0.0	1	439	1	439	Probable exopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgxC PE=3 SV=2
sp|A1D7I1|PGXC_NEOFI	6.93e-247	1	437	1	439	Probable exopolygalacturonase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxC PE=3 SV=1
sp|Q2UQ40|PGXC_ASPOR	8.81e-247	6	436	7	435	Probable exopolygalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgxC PE=3 SV=1
sp|B8MZZ6|PGXC_ASPFN	8.81e-247	6	436	7	435	Probable exopolygalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999741	CS pos: 28-29. Pr: 0.4370

TMHMM  Annotations     

There is no transmembrane helices in PWY68261.1.