CAZyme Information: PWY67929.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY67929.1
• CAZy Family: AA3
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841	MSFL01000039|CGC3	92629.36	5.7868

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000039:178748-181479(-)

Full Sequence      

MASQSQSPDIEVLLHKLTQEEKVSLLAAKDWWRTPVIQRDEVFVPHIKSTDGPNGARGES
YVSGIKAACFPCGTSLGASFDRELLYRNGQEIANEARTKAANVLLAPTLNVIRSPRGGRN
YETYSEDPFVLGVLGAAFVRGCQSAGIAATPKHFVANDTENSRQVLSAEIDEQTLREIYL
LPFQLVMKLSDPWCFMTSYNRVNGTYVADDARLVNGVLRGEWGFAGSVISDWMGVYSTAA
SINAGVDLEMPGPTRWRGEKLIQALNDGEVRPRTVDESAGRILELARRLGRFDNPNEPPE
RAVENADRDRFIRDAAAESMVLLKNEGILPLPGNATVALIGHHALNASLGGGGSARVDSL
HAVSPVEGLAKAGFAVNASPGIPVFGALPHADPSVLDASESVRVEWFNGRVIGENLVHQE
WKALPEYMIKEQWPSYLTAEYCTRITFDVWPVTSGDHILSVISTGPAIVHVNGEKIFTRP
QETDLRPESFYFFKSKLERRFTHPMEAGKSYTLVLESWNTDPAILHAKPLFGRMFQGSSL
RFHEHIDVPARIHAACQAAQQSDYAIVCTGTTSEIESEGFDRDTMDLSSHQYEQILAIAA
HNPRTIVVNFSGGPVGLTQFLSLVPAAIQAWFPGQEGGHSLARVLNGAVNPSGRLPFSWP
RRDEDNPSHGNFPCDDNNIVRYEEGLAVGYRHYDRKDSPEPLFPFGYGLSYTEFDVKNVK
VVEGMLSGPGDTVSVVCDVENIGDRSGAAVVQYYVEFPPVRIGHRRPPKELKEFQKVRLD
AGERKGVAITLDKYSVSFYHASERCWQAVAGKYRVHVGLSSREICGAVDLTVTEDFQWTG
V

Enzyme Prediction     

No EC number prediction in PWY67929.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	44	251	4.5e-62	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.81e-68	44	372	60	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.54e-65	70	824	120	757	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	6.61e-48	546	690	75	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.38e-40	70	285	88	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	7.67e-40	13	792	56	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95967.1|GH3	0.0	7	841	2	851
QKD60297.1|GH3	0.0	13	841	10	834
CEF77881.1|GH3	0.0	13	841	10	834
CZS81178.1|GH3	0.0	13	841	10	834
CEI61625.1|GH3	0.0	5	841	2	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.14e-156	9	841	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.60e-152	9	841	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	5.57e-115	9	824	4	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.54e-100	14	835	9	666	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	3.78e-91	13	832	57	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	5.79e-174	10	830	11	836	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	7.30e-174	10	835	2	813	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	3.72e-166	9	824	5	822	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	2.83e-162	9	817	5	816	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.08e-161	9	841	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000005

TMHMM  Annotations     

There is no transmembrane helices in PWY67929.1.