CAZyme Information: PWY67411.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY67411.1
• CAZy Family: CE8
• CAZyme Description: glucan 1,3-beta-glucosidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MSFU01000022|CGC2	43192.00	4.4447

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000022:368226-369386(-)

Full Sequence      

MYNLLGFLAALGCAQTALAAPFASPPNSSYIDWRTFKGNGVNLGGWLVQESTIDSYFWDT
YSGGASDEWGLCEHLGAQCGPVLEHRYATWITKADIDKLASAGITVLRIPTTYAAWIDLP
SSQLYSGNQTAYLREIADYAISTYNMHIVIDTHSLPGGVNGLTIGEATGHWYWFYNETNF
NYSLQVIDQVINFIQTSGSPQSYTLEPISEPADNNTNMVVFGTPLALTDHGAAWVLKYIR
AVIQRVASVNPNIPVMFQGSFKYPQYWEGDFPASTNLVFDTHHYYYEHMDSTSENLPEYI
LADAREKSGTGKFPVFVGEWAIQATYNNTFALRKRNVLAGLDIWQSYSQGSAYWTAKYTG
NTSVDGQGEQKDYWCYETFIDDGYFS

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	87	367	2.4e-154	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	9.58e-08	90	321	24	237	Cellulase (glycosyl hydrolase family 5).
225344	BglC	1.21e-06	35	181	15	161	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR97554.1|GH5_23	4.41e-289	1	386	1	386
BCS10017.1|GH5_23	4.41e-289	1	386	1	386
CAK39791.1|GH5_23	3.19e-282	1	386	1	386
QHN63926.1|GH5_23	6.17e-280	1	386	1	386
BAE61018.1|GH5_23	6.74e-205	5	384	5	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1A_A	9.03e-270	20	386	4	370	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
6LA0_A	4.07e-200	20	384	1	363	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6ZB9_A	2.12e-11	37	385	2	386	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	1.20e-10	37	385	2	386	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	5.62e-28	28	320	32	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q9URU6|EXG1_SCHPO	6.34e-24	27	321	28	314	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1
sp|Q0CR35|EXGA_ASPTN	8.33e-23	1	320	2	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	3.89e-22	40	321	44	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	5.29e-22	40	321	44	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999782	CS pos: 19-20. Pr: 0.9853

TMHMM  Annotations     

There is no transmembrane helices in PWY67411.1.