CAZyme Information: PWY67369.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY67369.1
• CAZy Family: CE5
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A317V124]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MSFU01000022|CGC4	41454.62	4.6509

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000022:268608-269744(+)

Full Sequence      

MSGLLGSRSWWLPSPGSRGFCYLFVYLAALFTLTPVVHAAVAVEPGAFGQLSQLADNPSF
SSATTNEGSETWSPVTNSMQLGDGKEEQDALQMMTFMKDATQTDSASTVISKDTMQNGNL
RVMIVGDSMSQGKEGDYTWRYRIWEWFRAQNIAVQLVGPYTGTAPSEPQAHGELQHQATL
GQPPTSGGYAPDVSPDFDRHHFAVWGRMAAIDKDLIYDVLSAHQADLMLLMLGFNDMAWF
QSDASGTLDSIRTLVINARAANPNLKFAIANVPQRSLIPGREDIPFNTHIYNALLRNAVP
EWSTADSPIHLVELQENYDCGPDACPAGYDGLHPNPVGEYQIARAFSLTLVKDYGIGNTP
LIIPDKIPERPPHLSFSF

Enzyme Prediction     

No EC number prediction in PWY67369.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	120	347	4.6e-50	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.11e-39	198	350	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	2.22e-07	217	342	54	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	5.60e-06	210	346	51	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238868	XynE_like	1.29e-04	218	350	68	204	SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238872	SGNH_hydrolase_like_2	1.43e-04	204	347	46	189	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39824.1|CE0	4.81e-236	1	378	23	395
BAE63679.1|CE0	3.96e-119	94	371	32	311
BAE60780.1|CE0	2.86e-92	165	371	19	222
UKZ09962.1|CE0	4.17e-90	120	371	512	769
SCG40251.1|CE0	3.96e-85	116	371	332	591

PDB Hits     

PWY67369.1 has no PDB hit.

Swiss-Prot Hits     

PWY67369.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.239804	0.760182	CS pos: 39-40. Pr: 0.7295

TMHMM  Annotations     

Start	End
20	42