CAZyme Information: PWY67145.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY67145.1
• CAZy Family: AA3
• CAZyme Description: pectin lyase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	MSFL01000041|CGC1	52899.15	4.4132

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000041:32146-33881(-)

Full Sequence      

MLILLWSGLVAGQLIGPVGPTNSLAQKTIECSITDYGAVADNQTDIASALESAFSECVLP
NRGSRLVVPEGDYLLGRGVVLSNGTNWAFQLDGLITAAYGGNWTIDRGLILQGFAGADLL
NATVNGEGDHEFLLDVLVIVNAVDFEFFSATGRGAFQGQGYLYRNLDNTDRPRLVRLISP
TNASVHDLILVDSPKFHLVLDFAVNVEVYHITVRGANLGSYDGIDAIGTNYYIHDNEVTN
RDECVSVKSPSHHALIENLVCNQAGSGVSIGSLNVSAEISNIARPPPLCPFVAQNISIIQ
GNNIAFIKTYPGGSGYVRNVQFLNFRSKASLYGLDIDQYWQNTLEPDTGSVALSNLTFRN
FSGSVADGAQRPPLYLIANDLTYATNVTVADFTVWTEAGDEVVNKINNVFGTGDDSYGPQ
DGISSLSPGAVPHLYTSTYTITASPTGWVAPTYPAWAAPSTGYGTASPIPVYTPAPLWRP
GGVDYHLHYWGSF

Enzyme Prediction     

No EC number prediction in PWY67145.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	140	405	5.9e-45	0.7692307692307693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	9.13e-21	148	371	56	283	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	4.55e-17	32	366	69	383	polygalacturonase ADPG
215540	PLN03010	6.28e-16	32	416	48	396	polygalacturonase
227721	Pgu1	3.99e-15	15	322	68	390	Polygalacturonase [Carbohydrate transport and metabolism].
215426	PLN02793	8.21e-15	33	366	55	369	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD82401.1|GH28	2.54e-295	1	493	4	487
BAE57693.1|GH28	2.96e-294	1	493	4	487
QQK39531.1|GH28	1.18e-289	9	493	14	489
AEO66493.1|GH28	2.66e-272	2	493	8	489
QMW40025.1|GH28	1.91e-271	1	481	4	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	3.91e-91	13	485	1	417	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ARE6|RHGA_EMENI	7.44e-98	1	485	6	435	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|A2QYE5|RHGA_ASPNC	3.91e-97	9	481	15	432	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|P87160|RHGA_ASPNG	7.78e-97	9	481	15	432	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1
sp|Q00001|RHGA_ASPAC	3.93e-92	9	485	15	435	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|B8NK45|RHGA_ASPFN	1.34e-90	9	485	16	437	Probable rhamnogalacturonase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000714	0.999258	CS pos: 12-13. Pr: 0.9470

TMHMM  Annotations     

There is no transmembrane helices in PWY67145.1.