CAZyme Information: PWY67019.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY67019.1
• CAZy Family: CE5
• CAZyme Description: oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		56108.36	5.8305

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000023:461097-462773(+)

Full Sequence      

MTYPTADYIVIGGGTAGLVVANRLSEDPNVNVLVLEAGPDRSSDERVQNPAAWPTLSGSE
VDWQFKAVPQPGLNNRDQDYAAGRLLGGTSAINGLAFVPPAPAGIDAWEALGNPGWSWQS
LAPYFHRSFHICPEAAPGDGPGAAASAATGPIEVTYPALAEPRNHTIIDAWNKTFADKGY
AFSDTLIPTPTTGTRPYTATITTTGVRSASTQYAASRPNLRILTNTTVERILFDTTSTTI
TATGVLLHNDPSPITATKEVILATGAFNTPKLLELSGIGSASRLSTHSIPCIIDNPSVGE
NLNNHLMAVLPVPIQPLPDTASPTPGVQAISFVRSGAEADLLSRHPPHPPLNNLLANPSE
PTACFFLSTLPNSMAIFGLIPSYPLSRGSVHLSSSQPTDKPIIDPDYLSHPLDIKLMAAH
FKTLHSLPTCSPLSGILGSAPGPSPETQDPGVVEETLRASVVAAHHFCGTAIMAPREKGG
VVDTELRVHGTGNLRVVDASVFPTVTAANPMSTVYAVAERAAEIIRGRDRPACA

Enzyme Prediction     

No EC number prediction in PWY67019.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	526	4.5e-148	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.27e-99	4	532	6	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.28e-95	1	529	1	535	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.69e-42	384	521	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.14e-24	5	528	55	580	Protein HOTHEAD
366272	GMC_oxred_N	8.02e-22	74	306	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12736.1|AA3_2	0.0	1	534	4	537
CAK96464.1|AA3_2	0.0	1	528	1	529
BCS00980.1|AA3_2	0.0	70	534	7	471
QRD83786.1|AA3_2	1.82e-146	6	526	4	530
QMW32332.1|AA3_2	1.82e-146	6	526	4	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	5.34e-74	1	526	1	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.35e-55	7	526	3	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3LJP_A	4.89e-55	7	526	15	527	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	1.81e-54	7	526	15	527	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
2JBV_A	1.81e-54	7	526	15	527	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	4.39e-72	7	525	15	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	4.65e-68	7	527	48	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	4.65e-68	7	527	48	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	2.80e-63	7	526	15	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.80e-63	7	526	15	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000010

TMHMM  Annotations     

There is no transmembrane helices in PWY67019.1.