CAZyme Information: PWY66740.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY66740.1
• CAZy Family: AA3
• CAZyme Description: pectin lyase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		39071.48	4.0173

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000043:78569-79832(+)

Full Sequence      

MKYAVAFSAIAALAARAAAVGVSGTPEGFASSATGGGSATAVYPSTTSELVSYLGDDEER
VIVLTKTFDFTDSEGTTTTTGCAPWGTASNCQLAIDQDDWCENYEPDAPTSSVTYDNAGV
LGITVNSNKSLIGEGTSGVIKGKGLRMVSGVSNIIIQNIAVTDINPKYVWGGDAITLDDA
DLVWIDHVTTARIGRQHYVLGTEADNRVSITNNYIDGESDYSATCDGHHYWNVYLDGSSD
KVTFKGNYLYKTSGRAPKVQDNTYLHIVNNYWDNNSGHAFEIGSGGYVLAEGNYFSDVDT
VLETDTFEGALFSSDSSSSACEDYIGRACVANVNGGDLTGTSTTALEAFNGDTLATAAAA
NTSPASTAGQGNL

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	113	296	2.9e-93	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	3.59e-58	112	299	3	190	Amb_all domain.
366158	Pec_lyase_C	7.25e-16	123	295	30	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
226384	PelB	1.13e-15	123	297	97	275	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
GAA92866.1|PL1_4|4.2.2.10	2.59e-238	1	373	1	373
BCR99717.1|PL1_4	2.59e-238	1	373	1	373
AAA32701.1|PL1_4|4.2.2.10	8.63e-237	1	373	1	373
CAK47350.1|PL1_4|4.2.2.10	1.23e-236	1	373	1	373
CAP80630.1|PL1_4	2.83e-219	1	373	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	5.40e-182	20	373	1	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	3.11e-181	20	373	1	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	5.96e-160	21	357	2	341	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P22864|PELD_ASPNG	1.53e-237	1	373	1	373	Pectin lyase D OS=Aspergillus niger OX=5061 GN=pelD PE=1 SV=1
sp|A2RBL2|PELD_ASPNC	2.18e-237	1	373	1	373	Probable pectin lyase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelD PE=3 SV=1
sp|Q2TXS4|PELD_ASPOR	2.87e-208	1	373	1	375	Pectin lyase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pel2 PE=1 SV=1
sp|B8NVB7|PELD_ASPFN	2.87e-208	1	373	1	375	Probable pectin lyase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelD PE=3 SV=1
sp|B0YCL3|PELB_ASPFC	3.34e-200	1	373	1	375	Probable pectin lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000335	0.999634	CS pos: 19-20. Pr: 0.4579

TMHMM  Annotations     

There is no transmembrane helices in PWY66740.1.