CAZyme Information: PWY65760.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY65760.1
• CAZy Family: CBM48
• CAZyme Description: cell wall glycosyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443	MSFU01000026|CGC5	49294.65	4.1842

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000026:35171-37215(+)

Full Sequence      

MTQSFLPFTAALLTGLLSHSQPAAAVGISCDPDTRPYSAWMTDSVIARRDAILGDFTPGD
DIYPNISQVTLFESTVTRLKEYYDADSCGQVDWHSYALDGAESLLPAVQDVSFIVNAPLT
IFASGDVMYHQYDRAPNDTYKQALDNLHDAFNARTRDSEGAFWYFNPYPNWGVLEGLFPL
SSFISMWKTYFDPTNTTLTDSLTLSLDLFKDHCHDDSSGLLFHGYDSSKTASWADPTTGA
SPYVWNRALGDWFMTLVDLLERSGKNSAILNETQRDDVYTKYWNVANTIINDADEETGCW
WQVMLHGGEEGNYIESSGSAQFVYGLLKGARLGYLQGETPNGVAYTDAADKCYNYLLSEF
VKEEADGTLGYNGTVADCGLYDPTFETDEEAESRESREGKPLSLKPCLSIGSLRGRWGKS
LTITQMAMTLSSKRELNYCPELI

Enzyme Prediction     

No EC number prediction in PWY65760.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	122	388	9.1e-58	0.7379518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	5.93e-28	131	376	84	306	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
226678	YesR	3.14e-27	137	367	97	311	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99486.1|GH105	4.24e-292	1	386	1	386
BCS11787.1|GH105	4.24e-292	1	386	1	386
CAK42095.1|GH105	2.15e-274	1	389	1	389
BAE63195.1|GH105	5.59e-103	9	380	13	383
QRD85043.1|GH105	1.84e-102	9	380	13	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.72e-37	124	380	79	322	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.66e-31	86	369	55	324	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	7.43e-31	86	369	45	314	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	2.40e-30	86	369	55	324	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.63e-19	216	380	35	190	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.63e-19	216	380	35	190	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000332	0.999647	CS pos: 25-26. Pr: 0.9396

TMHMM  Annotations     

There is no transmembrane helices in PWY65760.1.