CAZyme Information: PWY65730.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY65730.1
• CAZy Family: AA11
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516	MSFL01000049|CGC1	58804.21	8.6929

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000049:118953-120829(+)

Full Sequence      

RHSIYDVYQKAKERRIALQRKYWVQLLFEYTVYIVLLAFVYFVLIGMPLWRGAVWWLYYV
VRTNYAFAPLLVLFEKNPPPVDNQTEKDIEQNRNTAKSTALLIPCYKSANIIGPTLDAAL
KIFPPENIFVIANGNSPEPLDNTEEVCRPYGVNHLWCPVGSKIIAQFVGCYAAKDFPYAL
LIDDDCALPPNFPVVSDRLKGRVQCVGYTIKSVGPESSRGTLCQQAQDLEYKISGLQRAF
AGYLGSATFPHGAISIWKTDFLKQTFHDHPGFSVSEDWFFGDSCRRLGGRITMCSSVFVE
TETPSAVFFSRGGSRGGFGEMTIFKQRFTRWNFFFVNGMWFNMKYILCSWSLGWWELGAK
LFVFQEVYETLLYLLAPFILPISFVVQPSFCGIMLGATNGLYFLNVIIFNLVHLRRKNES
VGWICLLVYYMPYKIVLFIINVVSCYWSLFKYARYFATRHPKVIEDDKAVETEEKGSGLG
RSFSVTKVRARKASNQGPSPTVPEAVPVVGIESSWV

Enzyme Prediction     

No EC number prediction in PWY65730.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	99	307	1.3e-25	0.9260869565217391

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404520	Glyco_tranf_2_3	1.89e-31	99	305	4	215	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
404513	Glyco_trans_2_3	6.25e-06	178	386	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
132997	Glyco_tranf_GTA_type	8.47e-05	102	192	2	94	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR93365.1|GT2	0.0	1	516	166	714
CAK44102.1|GT2	0.0	1	516	166	712
BCS06011.1|GT2	0.0	1	516	166	714
QKX60961.1|GT2	5.61e-262	1	492	166	687
UPL00273.1|GT2	2.61e-258	1	516	170	704

PDB Hits     

PWY65730.1 has no PDB hit.

Swiss-Prot Hits     

PWY65730.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000005

TMHMM  Annotations     

Start	End
23	45
55	74
331	353
363	385
390	412
427	449