CAZyme Information: PWY65606.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY65606.1
• CAZy Family: AA1
• CAZyme Description: concanavalin A-like lectin/glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	MSFL01000051|CGC1	34897.87	4.7425

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000051:140718-141743(+)

Full Sequence      

PSTLCDCYINTPTPSDPDTTIFTHYKLWDFRNVPLPALSIESTPTNPSSPSSLLETYPLT
KTPFDSDWRAQNWQRNATPLGPIPMINTDRNVFLLKDVTSSPQDPKSSFLVLRTTRFPDH
ASTAELDGQFGPVYHCSLRVRMRIMSEREILRAAGKVRKDKNTVDSKTNSNSNSKTDPIP
PGTCAGIFTYLTPTCESDIEILTSEDPHTIHYANQPDYDPVSDTSIPGSSTTVNLSTPWT
LWTTHRLDWHAGSSVWFADGQVVSNLSYSVPDQPSVVAVNLWSDGGNWSGDMKVGESVFM
GIEWIEMLYNVSSS

Enzyme Prediction     

No EC number prediction in PWY65606.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	66	307	3.2e-78	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.26e-34	70	307	10	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99502.1|GH16_22	8.81e-141	1	314	33	344
BCS11802.1|GH16_22	8.81e-141	1	314	33	344
CAK42110.1|GH16_22	1.33e-139	1	314	34	346
EAA63092.1|GH16_22	1.26e-93	5	314	51	338
QMW33413.1|GH16_22	1.52e-91	2	313	31	336

PDB Hits     

PWY65606.1 has no PDB hit.

Swiss-Prot Hits     

PWY65606.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PWY65606.1.