CAZyme Information: PWY64384.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY64384.1
• CAZy Family: AA7
• CAZyme Description: glycosyl hydrolase family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457	MSFU01000031|CGC1	49404.41	4.1633

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000031:209358-210835(+)

Full Sequence      

MVFAHYIAAAFTVAALAGTPAAIDLDITDEQSIKDAAATAAFNAMSYYTGNQTGQIPGYI
NHTWWEGGVLFDTMIRYWYFTNDASNNAAVSQGIYHQRGAGNDYMPSNWSSYMGNDDQVA
WGLAAMTAAELNYPEDAGMPSWVDLAERVFDVQSARWDNSSCEGGLRWQIWPYQVGYTMK
NSMSNGGLFQLAARLARYTNNQTYVDWADTIWDWSSRILVDQESWNVADSTNAENDCTNL
GNNQWSYNYALYLSGAAYMYNYTNGETTQWKTALDGLLNSTLQTFFPAKFGGEIMSEVLC
EPANVCNDNEITFKGLLAESLTITSMLAPYTSSDILPRLQGSAVGAAKQCSGGSSKATCG
QHWYQSSWDGTEGIEEEMSATSIFTSNLVAYKHLSPATKTTATNVTSSAGTDTGNGTTTA
STTAGSNSVVPTNGANSLPCRHFGVAVAIVAGAFAIA

Enzyme Prediction     

No EC number prediction in PWY64384.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	30	399	5.5e-97	0.9581005586592178

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	5.39e-161	32	380	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	3.09e-05	117	253	93	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13375.1|GH76	0.0	1	457	1	457
BCS01664.1|GH76	0.0	1	457	1	457
CAK44952.1|GH76	8.29e-282	1	457	1	457
BCS03764.1|GH76	1.62e-167	23	412	23	414
BCS15380.1|GH76	1.62e-167	23	412	23	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.03e-86	27	391	30	406	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	7.79e-97	22	383	21	380	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	7.89e-95	22	380	19	376	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	3.93e-93	23	396	19	389	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q9P6I3|YHG7_SCHPO	2.76e-92	27	384	24	375	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	8.17e-91	22	398	18	397	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000357	0.999597	CS pos: 17-18. Pr: 0.9422

TMHMM  Annotations     

There is no transmembrane helices in PWY64384.1.