CAZyme Information: PWY64047.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY64047.1
• CAZy Family: AA1
• CAZyme Description: Chitin-binding type-4 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A317UU34]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299	MSFL01000070|CGC1	30786.97	4.1567

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000070:37157-38056(+)

Full Sequence      

MKTTGSVLALAGLVSLVHGHGFVTSPNPRLPGSAMEAACGQQVYDNQESNKYGNIQNMLQ
VAADQSDYNATACDIWLCKGYKFADNKDNVYSYKPGEVVDFVVDIMAPHTGTANVSVVQT
STDTVIGSPLIYWSVYASTATGVTKNETNFSVTIPDDLGDKCATGGDCVLQWWWNAASIN
QTYESCVDFTVSGSASSSSSSDASTSSAAAVSEPTTTNAAATVSTPDTANNIAPASSSAP
TTLATSIKQAATTTPAAVAVAVATASASASSVAIPTDGTSEEQLTWVASLLKALLKYAN

Enzyme Prediction     

No EC number prediction in PWY64047.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA16	20	189	4e-73	0.9940119760479041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	6.38e-08	20	189	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05968.1|AA16	1.04e-116	1	299	1	299
BCR93324.1|AA16	1.04e-116	1	299	1	299
CAK37296.1|AA16	3.92e-116	1	299	1	297
QLE11222.1|AA16	3.99e-102	1	297	1	288
CAF32158.1|AA16	3.99e-102	1	297	1	288

PDB Hits     

PWY64047.1 has no PDB hit.

Swiss-Prot Hits     

PWY64047.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999750	CS pos: 19-20. Pr: 0.9822

TMHMM  Annotations     

There is no transmembrane helices in PWY64047.1.