CAZyme Information: PWY63978.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY63978.1
• CAZy Family: AA7
• CAZyme Description: glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603	MSFU01000033|CGC1	66813.01	6.9375

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000033:201896-204041(-)

Full Sequence      

MHSGSQADLNSIHGHAYDFIICGGGTSGCVIASRLARIPNISVLLVESGRDAGLSPDVLI
PGNYVKQLQEDKAGLWELETVPQRHLKDRKLVFLRGKQLGGSSAVNYMALARGPAADYDE
WARLTGNDGWKWESVLPLMKELEDFDPRLPPGVEDFARPKPSDHGRSGQVKPEMVPGVET
FFKACVETGMPVCLDNNSGNPVGVGLAQFNVRRGERSYAANAFLDHSSRTRLPNLTIMTD
TECDKIYCADGTATGVELYHKPTQETADCFFKVYIRCRREVVLCAGTFGSPKILMLSGIG
PLDVLNRHGILPVLNSPGCGRNMLDHSIITCEYKVDDKIPAHNQIFLDPDLHKQAKAQYA
DSRTGPLAMYGSSGTVAFPRIQRLFESKEFADLDGQTQKFLLDSTRPSAEIWLGSGPSFY
PANDPTKSYITHEMLIQNNLSKGTVTLRSRDPRDPPLVDPNFLSHPFDKRIAIETVRTAL
KVANTAAYRGTIERIVHGPRIDINSTKPDSIRDEELLDFIQDHLDQGYHSMGTCKMGARE
DPTAVVDDRFRVFGMRNLRVADLSVCPILTCNHTQINAYLIGIRCAQEMEKYYKGTTERA
GRL

Enzyme Prediction     

No EC number prediction in PWY63978.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	16	589	2.7e-152	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.72e-104	17	570	6	512	choline dehydrogenase; Validated
225186	BetA	3.54e-100	17	589	8	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	3.45e-65	18	587	2	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	3.00e-40	441	585	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.78e-39	89	326	17	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23649.1|AA3_2	0.0	1	603	1	592
QSS73506.1|AA3_2	7.87e-99	17	595	5	565
QMW45359.1|AA3_2	2.83e-98	16	593	4	561
QMW33321.1|AA3_2	2.83e-98	16	593	4	561
UDD61192.1|AA3_2	2.83e-98	16	593	4	561

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.23e-63	17	586	2	558	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.12e-63	17	582	3	555	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.24e-61	17	593	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5HSA_A	4.71e-59	17	586	7	629	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
3LJP_A	7.49e-57	8	600	5	537	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	4.85e-74	17	591	41	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|P0DO29|ERIK_HERER	2.08e-71	8	586	25	592	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|Q0CJ60|ATC_ASPTN	1.05e-69	16	589	45	593	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|Q47944|SDH_GLUOY	1.95e-66	17	586	5	524	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q988C9|4PADH_RHILO	6.93e-66	13	583	3	525	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PWY63978.1.