CAZyme Information: PWY63190.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY63190.1
• CAZy Family: AA3
• CAZyme Description: Six-hairpin glycosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1173	MSFU01000038|CGC3	127786.61	6.3405

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000038:45660-49359(-)

Full Sequence      

MRCHRLLSGVLALLPLSVAQSCWRNTTCSGPTDSAFSGPWEKNIFAPSSRTLNPEKLFLI
TQPDKTEDYTPFALHGNGSLVVYDFGKEVGGIVSVNFSSTGSGTLGVAFTEAKNYIGEWS
DSSNGGFKGPDGALYGNFTEAGSHYYVMPDKSLRGGFRYLTLFLITSDNSTIHIEDVSLE
IGFQPTWSNLKAYQGYFHSNDDLLNKIWYTGAYTLQTNEVPTDTGRQIPAMAEGWANNCT
LGPGNTIIVDGAKRDRAVWPGDMGIAVPSAFVSLGDLDSVKNALQVMYDTQNNSTGAFDE
SGPPLSQKDSDTYHMWTMVGTYNYMLYTNDSDFLEQNWEGYQKAMDYIYGKVTYPSGLLN
VTGTRDWARWQQGYNNSEAQMIPSLYHTLNTGAELATWAGNSGDLSSTWTSRAEKLRQAI
NEYCWDESYGAFKDNATDTTLHPQDANSMALLFGVVDADRAASISERLTDNWTPIGAVAP
ELPENISPFISSFEIQGHLTVGQPQRALELIRRSWGWYYNNANGTQSTVIEGYLQNGTFG
YRGNRGYYYDTAYVSHSHGWSSGPTSALTNYIVGITVTSPLGATWRIAPQFVDLQSAEGG
FTTSLGKFQAGWSKTDKGYTLDFSVPHGTQGNLTLPFVGTAKPSIKIDGTEITRGVEYAN
ATATVTVSGGGTIVTFNPLQCPPNAILPHPSNQGTSNHVSIIIRSAHFHRIPILQTTSIS
NPTKSTNTTYTNKMPPIPPSLRAARAQWRTCAQNLHASTNPKTRLYSTTRTLRSTTSTTA
SNPLRSAARAPRSREQDLARSKRSMYISATGMIVCAIGMYGVIKADVFGLEQTTTTTTTT
DGVEVENTTTTSGSTKLDGPSTGFPTKPTLTHIQSSSGNPDQVETGTSSIPHFPAVIHLP
KWLESEDNTPASATDLPVQSNGKESDGEEYHLLGLGIRTVSFLNFQVYVVGLYVAKEDLA
ELQSRLVRTAVHPPGEGTESVIDNEVGATAATSLVSMEREKLRELLLDAEKGEQAWDMLL
KKDGLRTAFRVVPTRNTDFLHLRDGWVRGITGRAQRYNKVEGGGKGEFEGEEFGQAMGEF
KGLFGGGQRKSVPKGQVLVLARGKKGQLDVLVQGGGDGKDTLPDRYLGRVKDERVSRLVW
LNYLAGKNVSSEGARRSVVDGIMGVVERPVGTV

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	80	635	6e-97	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406443	Chalcone_2	7.57e-84	928	1159	1	203	Chalcone isomerase like.
407469	Bac_rhamnosid6H	5.10e-16	195	470	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	2.63e-06	579	650	3	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225942	GDB1	2.80e-05	234	476	259	515	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
273702	oligosac_amyl	5.56e-05	307	486	351	525	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43282.1|GH78	0.0	1	1173	1	1131
UCK57529.1|GH78	0.0	6	672	12	680
QRD88907.1|GH78	0.0	6	672	12	680
QMW37218.1|GH78	0.0	6	672	9	668
QMW25160.1|GH78	0.0	6	672	9	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	9.95e-17	157	606	273	670	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BN19|AIM18_DEBHA	3.25e-24	929	1165	98	297	Altered inheritance of mitochondria protein 18, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=AIM18 PE=3 SV=1
sp|Q75DU9|AIM18_ASHGO	5.73e-20	915	1166	93	304	Altered inheritance of mitochondria protein 18, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=AIM18 PE=3 SV=1
sp|Q6CWH8|AIM18_KLULA	1.28e-15	929	1163	109	312	Altered inheritance of mitochondria protein 18, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=AIM18 PE=3 SV=1
sp|C5DFS5|AIM18_LACTC	7.46e-13	929	1166	99	305	Altered inheritance of mitochondria protein 18, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) OX=559295 GN=AIM18 PE=3 SV=1
sp|A7TPW4|AIM18_VANPO	1.53e-12	911	1166	91	316	Altered inheritance of mitochondria protein 18, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294 / BCRC 21397 / CBS 2163 / NBRC 10782 / NRRL Y-8283 / UCD 57-17) OX=436907 GN=AIM18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.016176	0.983800	CS pos: 19-20. Pr: 0.9158

TMHMM  Annotations     

There is no transmembrane helices in PWY63190.1.