CAZyme Information: PWY62300.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY62300.1
• CAZy Family: AA3
• CAZyme Description: galactosyl transferase GMA12/MNN10 family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258		30016.99	4.5853

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000046:34204-35048(+)

Full Sequence      

MVYGNRTSYYRGLKTHEDHSLKFGYPMTVLRKPILGGYWSKPAILLSALVEEMEKPEEDQ
AEWLFWFDGDTILMNPNIPLEIFLPPPQFDDTHLLMTSDWNGMNNGVFFIRVNQWAIELL
SATLAYPTSHPEVSLLFADQSAMDNVILKHEYFRRSIVFYPLRWFNAYPRNADAVDLNPD
RPVDSQVHHGDLLVHFPGAPPDRFDEIMDPYLKVAEAHTPEWELPLQKTGYMKEITDFWR
DRHELLFGDTPESSDNLA

Enzyme Prediction     

No EC number prediction in PWY62300.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	13	202	5.3e-31	0.8617886178861789

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	5.14e-18	37	198	59	231	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	2.21e-08	19	122	163	264	xyloglucan 6-xylosyltransferase; Provisional
215616	PLN03181	4.59e-06	28	122	172	265	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96623.1|GT34	5.43e-123	1	254	1	242
QKX62037.1|GT34	3.47e-96	1	240	307	548
BCS22997.1|GT34	1.95e-95	1	241	69	308
BCS22806.1|GT34	6.90e-94	1	255	121	378
QKX54237.1|GT34	4.43e-91	1	239	44	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BSU_A	7.15e-07	19	122	70	171	Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSU_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94622|YBKD_SCHPO	7.48e-10	17	198	136	332	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|A2X933|GT7_ORYSI	3.76e-09	28	132	164	267	Probable glycosyltransferase 7 OS=Oryza sativa subsp. indica OX=39946 GN=GT7 PE=3 SV=2
sp|Q6Z5M3|GT7_ORYSJ	3.76e-09	28	132	164	267	Probable glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=GT7 PE=2 SV=1
sp|Q09679|GMH1_SCHPO	9.57e-09	17	198	119	310	Probable alpha-1,2-galactosyltransferase gmh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh1 PE=3 SV=1
sp|Q564G7|GMGT1_CYATE	7.09e-08	11	132	142	265	Galactomannan galactosyltransferase 1 OS=Cyamopsis tetragonoloba OX=3832 GN=GMGT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PWY62300.1.