CAZyme Information: PWY61743.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY61743.1
• CAZy Family: AA1
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511		57486.49	5.0104

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000055:18393-20132(+)

Full Sequence      

MGSATTSTLPPDFLWGFATASYQIEGAVTEDGRGPSIWDTFCKIPGRIAGGANGDIACDS
YHRTAEDIALLKECGAQAYRFSISCLNHPSSRSRIIPLGGRNDPINEKGVQHYVRFVDDL
LAAGITPLVTLFHWDLPDELDKRYGGLLNKEEFVADFAHYARVMFQALGSKVKHWITFNE
PWCSSVLGYNVGQFAPGRTSDRSKSAEGDSSRECWIVGHNILVAHGAAVKIYREEFKSRD
GGEIGITLNGMYRCLDTSSQLLLFNFSYIGDWAEPWDPENPADVEACDRKIEFAISWFAD
PIYHGKYPDSMVKQLGDRLPSWTAEDIALVHGSNDFYGMNHYCANYIKAKTGEADPDDTA
GNLEILLKNKKGEFIGPETQSAWLRPYALGFRKLLKWLSDRYGQPKIYVTENGTSLKGEN
DLPVEELLKDEFRTQYFRDYIAAMADAYTLDGVNVRAYMAWSLMDNFEWAEGYETRFGST
YVDYEHGQKRIPKDSAKQIGQIFSQYIEKTA

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	504	1.2e-148	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	8.40e-177	8	497	4	442	Glycosyl hydrolase family 1.
274539	BGL	7.96e-175	10	497	1	424	beta-galactosidase.
225343	BglB	2.00e-138	6	496	1	443	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	1.19e-103	7	496	28	473	beta-glucosidase
215435	PLN02814	8.59e-100	5	496	24	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12207.1|GH1	0.0	1	510	1	483
BCS00431.1|GH1	0.0	1	510	1	483
QEV81508.1|GH1	0.0	1	509	1	482
CAK47813.1|GH1	0.0	1	509	1	482
QRD82378.1|GH1	0.0	1	509	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	1.71e-269	8	509	25	498	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	7.98e-234	9	509	3	465	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	8.75e-231	9	509	3	465	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	1.74e-230	9	509	22	484	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	1.51e-228	9	507	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	2.35e-187	3	507	5	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	1.20e-170	5	508	2	461	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9SPP9|RG1_RAUSE	4.83e-134	7	509	20	517	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	6.21e-134	7	497	31	496	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|Q0DA21|BGL25_ORYSJ	2.56e-132	10	505	26	496	Beta-glucosidase 25 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU25 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PWY61743.1.