CAZyme Information: PWY61670.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY61670.1
• CAZy Family: AA1
• CAZyme Description: cutinase-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288		28726.58	4.0499

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000070:10537-11536(-)

Full Sequence      

MKSVVALSLLTTALGAPTQSVNHRSLLGRSSTGTSDGLGALESLFPISGASTGTSTSDGL
GALESLFPSSGTSTSDGLGALESLFPSSGTTTTSGSSGDFSSLFGRATTDSSTANDVTDN
TGCKELTFIFARGTSETGNMGTIVGPEVASDLKSLTSNKVAVQGVDYPADWAGNADMGAS
GGSTMASLVKQAISQCPNTTVVVGGYSQGAMVVHNAASQLSSGEIQAAVLFGDPLKAESV
DTLDSSKVKEFCATGDPVCENGSDVMAHLSYGDDAQTAAQFLVSAVGL

Enzyme Prediction     

No EC number prediction in PWY61670.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	123	285	4.8e-45	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	6.23e-49	123	286	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK39777.1|CE5	1.44e-84	1	287	1	275
AKA62190.1|CE5	1.30e-82	103	288	101	287
BCR96605.1|CE5	1.96e-82	111	288	111	289
BCS09111.1|CE5	1.96e-82	111	288	111	289
CAK96288.1|CE5	3.58e-82	111	288	108	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	4.95e-38	118	286	74	247	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	6.80e-27	123	287	21	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	1.53e-25	123	284	12	185	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	8.10e-24	115	282	16	194	Chain A, cutinase [Malbranchea cinnamomea]
1FFD_A	1.14e-23	123	286	31	207	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	3.19e-85	111	288	48	223	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	1.32e-40	123	288	31	202	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|A8QPD8|CUTI1_TRIHA	2.37e-40	118	282	74	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	1.99e-39	123	287	31	200	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|G0RH85|CUTI1_HYPJQ	2.18e-37	118	286	74	247	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000381	0.999633	CS pos: 24-25. Pr: 0.6339

TMHMM  Annotations     

There is no transmembrane helices in PWY61670.1.