CAZyme Information: PV10_08995-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_08995-t45_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	KN847526|CGC2	62983.26	7.0194

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847526:70742-72616(+)

Full Sequence      

MKSTHHTFDFIVVGAGAVTARNLADWHPKSTTLLIEAGGDNARNDLYVPSDRFTSPYKHP
EIVKNYLTTPQEHLNGRVLDYLRGIGLGGSSIANFLAYIRGSKADYDRWAAMVGDDSYQW
KSIVEDFKAIENLHCDDQGDDEFVRPIKQLHGYRGPLDITLPTKRQWPVGMELVAEAART
YGYPINPDQNSGESIGVGTVSTTTYNGRRTTSATAYLSNAPSNLTIWTNSEVTSILLENV
GVNNGTSTPKVLGVRLRDGRVVTATKETILSLGSIDTPKLLLLSGIGPKDELAAMGIPCH
VDLPGVGKEMIDHTYLVMAHHAKSDLSDVATFDANPAQVAAAHEQWMKDSTGPNAKRKTA
NLIGFLKVPPGHSSRREAAKLDPEVQAFLNHPNVPHYEVYWTGYSLEGYSHECFATALMM
MNPQSRGTVTLASSDPKHDPIISPNYFSHPYDQKTMVDGLRESLRFLEQGELSKHILGPV
IAPKSSSYEDLLDFIKENLLTILHPVGTVKMGRRDDPKSCVDSHFRIKGIQGLRVVDLSV
VPTITNNHTQATAYLVGHVGAKKISLDYSRSKL

Enzyme Prediction     

No EC number prediction in PV10_08995-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	565	3.3e-144	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	5.65e-97	5	567	5	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.07e-92	3	565	1	528	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.02e-39	423	558	1	141	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	7.54e-32	5	564	53	576	Protein HOTHEAD
366272	GMC_oxred_N	4.52e-26	75	314	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS48722.1|AA3_2	2.41e-138	7	568	4	563
QSS73506.1|AA3_2	1.92e-137	7	568	4	563
QDS74375.1|AA3_2	5.41e-120	8	568	11	566
QDS72994.1|AA3_2	8.17e-116	8	568	3	556
QRC97674.1|AA3_2	1.84e-115	7	572	4	567

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.43e-73	8	567	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.49e-73	8	567	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.62e-56	8	569	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3T37_A	1.45e-46	9	563	19	519	Crystal structure of pyridoxine 4-oxidase from Mesorbium loti [Mesorhizobium loti]
4HA6_A	2.63e-45	9	563	3	503	Crystal structure of pyridoxine 4-oxidase - pyridoxamine complex [Mesorhizobium loti]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	1.04e-61	7	565	6	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|C3MIE4|BETA_SINFN	3.17e-61	9	564	4	525	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=betA PE=3 SV=1
sp|Q3L1D1|PDH1_AGABI	7.78e-61	8	569	41	594	Pyranose dehydrogenase OS=Agaricus bisporus OX=5341 GN=pdh1 PE=1 SV=1
sp|B9JBA2|BETA_AGRRK	8.53e-61	9	564	4	525	Oxygen-dependent choline dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) OX=311403 GN=betA PE=3 SV=1
sp|P54223|BETA_RHIME	1.66e-59	9	564	4	525	Oxygen-dependent choline dehydrogenase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=betA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000025

TMHMM  Annotations     

There is no transmembrane helices in PV10_08995-t45_1-p1.