CAZyme Information: PV10_08955-t45_3-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_08955-t45_3-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein, variant 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601		65858.48	8.7238

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847525:3071743-3073660(+)

Full Sequence      

MVKNPGLIPGIKSIKAGDIAKRQKGMAEIMEACWRSCADLTEIEDEQPSKRKTRAFVAHA
IIANPPSFAHIHCAEKLGIPLHLMFTMPWSPTQEFPQPIANIKSTAQGPSANNESSYSIV
EMLTWQGLASVTNKFRRETLGLPELSTSAATTMIERLRVPYTYCWSPALIPKPKDWGSHI
DVAGFYFLPLGSQYQPPEDLAEFLAAGEPPVYIGFGSIVVDDPDAMTTLIFDAVKKTGQR
ALVSKGWGGIGGDKLEKPDGVFMLGNCPHDWLFQHVSAVVHHGGAGTTAAGIALGRPTVI
VPFFGDQPFWGSMVARAGAGPAPIHHKQLTADNLAQAILEALKPETLERAKELGNRIHEE
RGAETGAACFHQQLGVDRLRCALAPGRPAVWRVKTNDSKQGIRMSAFAATVLEHEGILDM
NLMRVYRPHEWRPEEMITGKNISTANPVVSKAGAFASGLINYPVNLAKAWGGLATEPYKG
AKKAGWRGFGKGLKTGVGGVLFPRRSLIGGRSYSIRAIYESMKERMDSETLSFILATRFA
EGFEDLRSSTEEERADVIKQWHQLDPDLKVSKKKNKAHPWSKAVSSDETVKEHETRVEEP
K

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	52	368	1.6e-58	0.7460732984293194

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.95e-68	26	372	85	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.69e-30	74	367	112	392	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
273616	MGT	2.83e-13	194	368	218	384	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	3.38e-07	211	364	278	428	UDP-glucoronosyl and UDP-glucosyl transferase.
223779	MurG	3.76e-04	279	356	256	341	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ29661.1|GT1	7.13e-197	1	466	219	698
CCD33816.1|GT1	7.40e-196	1	466	230	709
ATZ49754.1|GT1	7.40e-196	1	466	230	709
UPK97528.1|GT1	2.15e-193	1	569	197	893
APA09867.1|GT1	3.89e-192	1	466	230	709

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.23e-54	61	374	124	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.88e-54	61	374	144	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.43e-28	74	363	113	388	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	3.84e-25	167	357	183	365	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.07e-18	167	390	200	406	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	2.07e-101	1	374	219	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	5.33e-96	1	374	256	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|A1CYS1|ATG26_NEOFI	1.83e-59	28	374	998	1328	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1
sp|Q4WID6|ATG26_ASPFU	3.31e-59	28	374	989	1319	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
sp|Q0UY53|ATG26_PHANO	8.30e-59	58	380	1052	1374	Sterol 3-beta-glucosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) OX=321614 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000084	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV10_08955-t45_3-p1.