CAZyme Information: PV10_08955-t45_2-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_08955-t45_2-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763		83657.47	7.9622

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847525:3071101-3073660(+)

Full Sequence      

MASEKPAVSSKDPKCSDSDASLSRVPTPTSPIAFEQDGINTRIAVTEDGRVDIDISKTDQ
RLAQQIERIRLQTRQHEPRPPTPPPSYDKAAQSQPPPPLNIVIQIVGSRGDVQPFVALGQ
VLRQDYGHRVRLATHGVFKSFVEENGLEFFDIGGDPAELMAYMVKNPGLIPGIKSIKAGD
IAKRQKGMAEIMEACWRSCADLTEIEDEQPSKRKTRAFVAHAIIANPPSFAHIHCAEKLG
IPLHLMFTMPWSPTQEFPQPIANIKSTAQGPSANNESSYSIVEMLTWQGLASVTNKFRRE
TLGLPELSTSAATTMIERLRVPYTYCWSPALIPKPKDWGSHIDVAGFYFLPLGSQYQPPE
DLAEFLAAGEPPVYIGFGSIVVDDPDAMTTLIFDAVKKTGQRALVSKGWGGIGGDKLEKP
DGVFMLGNCPHDWLFQHVSAVVHHGGAGTTAAGIALGRPTVIVPFFGDQPFWGSMVARAG
AGPAPIHHKQLTADNLAQAILEALKPETLERAKELGNRIHEERGAETGAACFHQQLGVDR
LRCALAPGRPAVWRVKTNDSKQGIRMSAFAATVLEHEGILDMNLMRVYRPHEWRPEEMIT
GKNISTANPVVSKAGAFASGLINYPVNLAKAWGGLATEPYKGAKKAGWRGFGKGLKTGVG
GVLFPRRSLIGGRSYSIRAIYESMKERMDSETLSFILATRFAEGFEDLRSSTEEERADVI
KQWHQLDPDLKVSKKKNKAHPWSKAVSSDETVKEHETRVEEPK

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	213	530	5e-58	0.7486910994764397

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.14e-85	99	534	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.53e-43	101	529	4	392	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	3.38e-18	101	258	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	5.46e-14	110	530	7	384	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	2.90e-07	287	526	205	428	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ29661.1|GT1	2.56e-244	32	628	81	698
CCD33816.1|GT1	3.00e-243	32	628	92	709
ATZ49754.1|GT1	3.00e-243	32	628	92	709
CAE7219504.1|GT1	5.29e-239	31	633	56	674
QRD02566.1|GT1	7.65e-239	35	647	118	743

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	7.92e-75	106	536	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.33e-74	106	536	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	3.46e-31	99	525	1	388	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	6.87e-28	99	519	1	365	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.20e-19	99	552	1	406	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.14e-129	97	536	154	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	2.21e-125	97	536	191	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q0UY53|ATG26_PHANO	1.11e-77	94	542	948	1374	Sterol 3-beta-glucosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) OX=321614 GN=ATG26 PE=3 SV=1
sp|Q6C8M8|ATG26_YARLI	5.08e-77	106	540	1002	1417	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|A7KAK6|ATG26_PICAN	3.67e-76	106	536	795	1203	Sterol 3-beta-glucosyltransferase OS=Pichia angusta OX=870730 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000085	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV10_08955-t45_2-p1.