CAZyme Information: PV10_08484-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_08484-t45_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459		51510.08	5.3168

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847525:1664100-1665619(-)

Full Sequence      

MDTLPIVWRTGDPDLYEKARVGRIFNQRQPNRYPDAVVEAREAAHVVEAVKLAIERKCRI
AVRSGGHNWSASSVRDNSILVDLGNCHEMTLDQDTGIVQVSPSTTSAELNAYLRPFGRMF
AGGHCPDVAVGGFLLLGGVGWNARNWGCACEQVLAIEVVTADGRLLRADPTQNTDLYWAA
RGCGPGFPGVITRFHLQTRPLTKVMRSSLYVYPTSRYRSVFEWALELTPTFDNETEIVMI
STHPPGLDDLHLMVLFITFKDSEGSAKDALQPAEDSFPSDPVLHWFCQKTDLPNEYAGQD
HANPSGHRYHCENAYIRNGEDVVSVLEKAMTTSPSKETYTFWNPMFPWSRRSLPDMALSL
QADHYLAMYTICKDEVDDAKCMNWTRDIIADVKKYSVGSYLGDIDLQVRTTKFWGDEQAR
RLMDIRRKWDPNGVICGYLDAGDKSGVAGLDNQLDNDKD

Enzyme Prediction     

No EC number prediction in PV10_08484-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	23	434	1e-79	0.9759825327510917

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	3.36e-25	19	434	17	449	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	1.46e-21	34	169	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	4.37e-04	402	434	6	37	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	0.006	153	193	194	233	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK90596.1|AA7	8.44e-28	34	200	20	188
QUC19098.1|AA7	1.48e-27	34	200	48	216
AHG26149.1|AA7	3.93e-26	34	200	42	211
BAI44126.1|AA7|CBM18	2.45e-25	13	198	255	440
QBZ61916.1|AA7|CBM18	2.45e-25	13	198	255	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FYD_A	3.83e-24	6	435	22	453	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
5K8E_A	8.77e-24	25	198	53	227	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6FYF_A	9.43e-24	6	435	22	453	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]
6FYG_A	9.43e-24	6	435	22	453	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]
6FYE_A	1.27e-23	6	435	22	453	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2I6PJ02|NODO_HYPPI	8.14e-103	2	439	7	444	FAD-linked oxidoreductase nodO OS=Hypoxylon pulicicidum OX=1243767 GN=nodO PE=3 SV=1
sp|A0A0E3D8N6|PENO_PENCR	3.06e-100	4	440	9	443	FAD-linked oxidoreductase penO OS=Penicillium crustosum OX=36656 GN=penO PE=3 SV=1
sp|A0A140JWT7|PTMO_PENSI	6.11e-100	4	440	9	443	FAD-linked oxidoreductase ptmO OS=Penicillium simplicissimum OX=69488 GN=ptmO PE=3 SV=1
sp|A0A0E3D8N0|JANO_PENJA	1.05e-97	4	441	6	445	FAD-linked oxidoreductase janO OS=Penicillium janthinellum OX=5079 GN=janO PE=3 SV=1
sp|A5ABH0|PYNB_ASPNC	7.32e-27	14	432	58	522	FAD-linked oxidoreductase pynB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV10_08484-t45_1-p1.