CAZyme Information: PV10_07943-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_07943-t45_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412	KN847525|CGC1	46157.27	7.5058

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847525:19097-20513(+)

Full Sequence      

MAEILPKWQDKPQVVNKASTPTLRQVFKSPWKLMVFGLGCLVSLHLFSRMLSGSIIRRST
EMSAQSMPSDSLHDIYNSTLGFQKVFAIGFAERTDKRDAKTLASSFTDIDIEWLPAVSFE
QVSPKAAPPTWDFNRQAKGALGCWRAHMNALEHIVRHRIQTALIMEDDADWDVSLKDQLL
EFATGTRALQHLPPNSPSSSAYGSEWDFLWLGHCRVGSTDDDQEFWVIDDDSTSPPVKHR
WAGWTNRHFPDEVRRDGTRVILNAAGGGMCLYSYAVTYETARKILASVSLTSIDSPVDAS
LSEMCRGKLGNPLRCYAPYPPLLASHRAAGPQFRDSDLNEKGDKWHKAYTWDIVYSTVLN
IPRLVKGMATVNAQWPDHSRPEILWNSSLRASSKGYLKTIAVSNSTTSPNEP

Enzyme Prediction     

No EC number prediction in PV10_07943-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	82	299	2e-27	0.9834254143646409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	9.80e-19	84	172	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65939.1|GT25	3.65e-82	70	383	124	434
BCS10899.1|GT25	1.27e-81	61	377	40	353
BCR98565.1|GT25	4.35e-81	61	377	82	395
QMW48687.1|GT25	1.84e-80	70	383	43	355
QRD92316.1|GT25	1.84e-80	70	383	43	355

PDB Hits     

PV10_07943-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7Q021|GLT25_ANOGA	2.11e-06	74	304	310	504	Glycosyltransferase 25 family member OS=Anopheles gambiae OX=7165 GN=AGAP012208 PE=3 SV=4
sp|A5PMF6|GT251_DANRE	2.82e-06	80	216	320	454	Procollagen galactosyltransferase 1 OS=Danio rerio OX=7955 GN=colgalt1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000005

TMHMM  Annotations     

There is no transmembrane helices in PV10_07943-t45_1-p1.