CAZyme Information: PV10_07941-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_07941-t45_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		42210.44	5.8412

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847525:15461-16630(-)

Full Sequence      

MHLTQSKDAVVAHDTAPFGDTMTSAPCWKRNAGAKCRRLTQVAFVALTLCVLFIQKPCLL
PLPGYQQLMGEPRTWDAAAGGDASIESSVVPVTSAYKPLEVDILADFPKKIVQTTTTAGK
RDFEQMWKSWRDLNPDYTYWIMKDDVLDDFVDQHFSVRPAIKRFWKQLNTPVLRTDFLRY
LVMFARGGVYSDIDTSVVKPIHDWIPRRFLDDAEKPVNVVVGIERDQTKEGALRPIGFVQ
WTLMTKPGHELFEKAIYRVMSNIEFLAGVQRVPVDRVVIPKADAVEATGPGMFTDVVIEV
LREQGIGVDWLLFSNLTEPILLGDILFLPINAFCGRHCRSDSPEYGDIYVQHHHQNGWFS
SQPMEYSEQETT

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	123	206	3.5e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.79e-22	100	256	75	240	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.02e-13	128	207	9	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
USW54832.1|GT32	1.23e-67	128	361	10	244
UPL04319.1|GT32	1.22e-40	105	363	110	383
CCT68908.1|GT32	6.05e-40	107	363	107	378
QGI82113.1|GT32	6.05e-40	107	363	107	378
QGI64856.1|GT32	6.05e-40	107	363	107	378

PDB Hits     

PV10_07941-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	5.89e-38	100	358	135	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	4.80e-34	107	333	99	348	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	6.74e-29	107	365	130	394	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.12e-24	102	351	91	452	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P38287|CSH1_YEAST	4.02e-07	108	194	63	147	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999984	0.000030

TMHMM  Annotations     

There is no transmembrane helices in PV10_07941-t45_1-p1.