CAZyme Information: PV10_07353-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_07353-t45_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532	KN847524|CGC6	58070.36	4.2290

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847524:1713668-1715394(+)

Full Sequence      

MLTTIWTVTSILLIRAAQCATIVPLTAPSYASQPLLDSFVSFSIEFSSFPDFAGNSTHPN
TFSYNLLQNLWDLQGTPPIIRVGGNTQDYYTFDATQQEALVGSVDPSRSPDYPTTISIGP
SYFDSYTTWPGFSYVHGLNLGKNGTVGYDTLVATVPLVCQHLAATNRLAYWQLGNEPDLF
ETSTQGPVRPSWWAEPQYVEEYLNKTRIIRGLVQEHCPEVIEQDRLKYQAPSFAGTANNL
DLVTTWNEGIDADSEIALIDSHNYINGATAPGVTLQGTLMNHTSTVISVDKHIDEIRQPA
IADSGLPYILGETNSLYNQGAPGLSDSFGAALWGVDFNLYCAASGIRRVHMHQGTNYRYA
SWQPIDTNLATTATKAPYYGNIAVATFLGNTSASDNVRISELDLDSEPYHSAYAAYINDR
LERIALVQMQAYNSTDGGQGGDRPSETFTLQLDGDFSTVQEIEILRLTASGSNAVTDVSF
DGYSYSHDLDDGRPSLLPDVPRGEVVQVTSGGEVVVDLPWSSAAVLILKRSS

Enzyme Prediction     

EC	3.2.1.31:3	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	37	493	5.5e-77	0.9274725274725275

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	1.03e-22	412	525	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX60609.1|GH79	2.15e-183	28	532	32	530
XP_964763.1|GH79|3.2.1.31	2.41e-174	26	502	27	523
BAF75800.1|GH79|3.2.1.31	2.41e-174	26	502	27	523
CAK96418.1|GH79|3.2.1.-|3.2.1.31	5.31e-174	26	528	40	541
BCR93948.1|GH79	2.45e-172	26	528	40	541

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	1.01e-38	23	530	7	461	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5G0M_A	8.47e-22	50	482	37	436	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	9.19e-22	50	482	37	436	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]
5L77_A	2.29e-21	50	482	57	456	A glycoside hydrolase mutant with an unreacted activity based probe bound [Acidobacterium capsulatum]
5BWI_A	4.26e-15	51	517	29	444	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SFB0|GUS79_NEUCR	4.28e-175	26	502	27	523	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1
sp|A2QEQ6|GUS79_ASPNC	9.43e-175	26	528	40	541	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000462	0.999503	CS pos: 19-20. Pr: 0.9685

TMHMM  Annotations     

There is no transmembrane helices in PV10_07353-t45_1-p1.