CAZyme Information: PV10_07283-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_07283-t45_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	KN847524|CGC5	69142.91	6.0089

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847524:1496214-1498244(+)

Full Sequence      

MATTNGVNGANGVNGVNGTHKTAHVSVDEFVQQSYDYLIVGGGTAGLTVAARLTENPDVT
VGVIEAGKNRLGDPLVDTPALFTQMLGNKEYDWAYDTVPQAGNRNRIHQIPRGRALGGSS
AINYMMYVRGSDQDYDDWAALADDPSWSAKAMKQYMRKHQTLEPIDERITDRTTMPFVGE
NHGTSGPVRTSFNDSKLPIEDDIVKAADHAAGFDKKPIDPWSGDHIGFYNTLGSIVRTGP
NKGKRSYAARGYYQANENRPNLKVITESLVSRVILDNDIATGVEFVSAGQKYTVKAKREV
IVSGGAINSPQILELSGIGDPEILKAAGVDVKVNLPTVGTNYQDHVVGATVYQLAPGQMS
GEAVYIPEVMAAAQKALIEEQGGPLTSIQSVQGFFPIKIFLEDGELDEIIKSIQDTKPET
EFQKKQWEQVISHLKSDKSANFQMVFISVTGDLENGTADQSKLWPPPSSPDQPHGITFAL
CLQYPVARGTIHIKSADPTVYPTINPNYLNHPADIAVMGAAYKFAEKLCAAPVLEGKIGK
RVHPPPEQYPLNTVAERRKAAEAYCIGEYHSCGSCAMGSTVDSHLRVYGVKNLRVIDASV
FANNVSGNIVSSVYALAEKGADLIKQDWDYAALNKVAK

Enzyme Prediction     

No EC number prediction in PV10_07283-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	33	627	6.2e-169	0.9982394366197183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.20e-112	32	625	3	532	choline dehydrogenase; Validated
225186	BetA	7.42e-109	34	627	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.92e-38	485	619	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.57e-34	105	347	16	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.14e-21	33	601	54	553	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO22487.1|AA3_2	4.01e-260	24	634	16	626
SMQ52591.1|AA3_2	1.49e-256	24	628	26	630
SMR55413.1|AA3_2	1.49e-256	24	628	26	630
SMR57790.1|AA3_2	1.49e-256	24	628	26	630
SMY26225.1|AA3_2	1.49e-256	24	628	26	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.35e-69	34	627	5	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.22e-65	35	627	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.48e-65	35	627	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	3.01e-61	31	635	2	593	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6H3G_A	2.46e-56	33	627	5	623	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	2.09e-148	24	627	3	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	3.40e-144	23	627	2	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	3.40e-144	23	627	2	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	2.26e-87	23	627	28	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.86e-82	33	624	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000021

TMHMM  Annotations     

There is no transmembrane helices in PV10_07283-t45_1-p1.