CAZyme Information: PV10_07182-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_07182-t45_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757		84462.94	9.1336

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847524:1156332-1158879(-)

Full Sequence      

MAATTSTPLEPFLRSTTSKKTRALLRIIILVTIAAAAVSSRLFSVIRFESIIHEFDPWFN
FRATKYLVKHGFYSFWDWFDDRTWHPLGRVTGGTLYPGLMVTSGVIYHLLNLLSLPVDIR
NICVLLAPACSGLTAFAMYLLTSEMSSSPSAGLLAAAFMGIAPGYISRSVAGSYDNEAIA
IFLLVFTFYLWIKAVKNGSIMWGALAALFYGYMVSAWGGYVFITNLIPLHAFTLILMGRY
SSRLYISYTTWYALGTLASMQVPFVGFLPIRSSDHMAALGIFGLLQLVGFFNYLKEQLPG
KQFQTLLVALGGSIFAILLAALVFFTVSGIIAPWSGRFYSLWDTGYAKIHIPIIASVSEH
QPTAWPAFFFDLNMLIWLFPAGVYMCFRNLKDEHVFVVIYAVLASYFAGVMVRLMLTLTP
VVCCAAALALSHILDTYLFLGTPRGDAATDGSNGPVKASKTTANLTLRSMRNPLVGIYSV
VSKSLVSSLATGFLLLFVAHCTWVTSNAYSSPSVVLASRLPDGSQHIIDDYREAYYWLRQ
NTPQDAKIMSWWDYGYQIGGMADRPTLVDNNTWNNTHIATVGKAMSSREEVSYPILRAHD
VDYVLVVFGGLLGYSGDDINKFLWMVRIAEGIWPEEVRERDFFTARGEYRVDDQATPTMR
NSLMYKMSYYNFDKLFPSGQAQDRVRGSALPAQGPELNVLEEAFTSENWIIRIYKVKDLD
NVGRDHQSAVAFDKGHKKKRKTTHGAGKKGVRVLRED

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	25	672	6.6e-194	0.8484848484848485

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	7.00e-144	24	510	1	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	4.54e-114	19	724	13	737	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	1.32e-26	23	565	2	547	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW36082.1|GT66	0.0	7	757	4	742
QRD92953.1|GT66	0.0	7	757	4	742
QMW48142.1|GT66	0.0	7	757	4	742
BAE65548.1|GT66	0.0	7	757	4	742
UDD65301.1|GT66	0.0	7	757	4	742

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	0.0	22	724	13	690	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	6.61e-291	22	743	69	802	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	1.09e-266	19	723	12	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	2.19e-266	19	723	12	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	6.01e-264	19	718	12	696	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	0.0	25	739	24	738	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	0.0	22	724	13	690	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|E2RG47|STT3B_CANLF	8.42e-291	22	743	69	802	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q3TDQ1|STT3B_MOUSE	1.08e-290	22	721	66	774	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2
sp|Q8TCJ2|STT3B_HUMAN	3.40e-290	22	743	69	802	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000000	0.000002

TMHMM  Annotations     

Start	End
23	45
93	115
122	140
150	172
179	201
216	238
245	267
277	294
306	328
365	387
394	416