CAZyme Information: PV10_07017-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_07017-t45_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836	KN847524|CGC1	90737.74	4.8626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847524:606024-608631(-)

Full Sequence      

MGSLPVQTSFDVEDVLSQLDTSEKVALLSGIDFWHTAPVHRLGVPSIRLSDGPNGVRGTR
FFNGVPAACLPCGTGLAATWDTNLIKQGGALQGVEAIGKGASVILGPTTNMQRSPLGGRG
FESFSEDPYLAGAMSAATINGIQSTGVAATIKHYVCNDQEDQRQSVDSIITERALREIYL
MPFQIAQRDSSPDCYMTAYNKVNGTHASESPRLIRDILRGEWGFDGLVMSDWFGTYSTTE
AIKAGLDLEMPGPTYIRGKLVNQALGCGKLTIQEVDARVREVLKLVKKVQPLGIPENAPE
QTYDTPETSALLRAISSNGLVLLKNEGSVLPFHKEKTTAIIGPNAAYASYCGGGSASLAP
YYAISPLDGLRSKVPDAKYELGCPAWKSVPLMSNLTKTKDGQVGLTMNVFLEPATVPNRM
SIDEVFVNKSDILLVDYKHPLIKNYLYWLELTGTFTPEETAEYEFSLACAGSGKIFVNGE
LVVDNETVQRPGNTFFGAGTAEEIGVLKLEQGVAYDIVVKFGTFPTMSFTTPGTTGFGSG
GLRVGLERKAEISKEIERAVKLAKEVDQVVLCAGLNSEWESEGYDRENMHLPPGVDDLIR
AVVAVNPNTAVVLQSGTPVTLPWLNEVPALVQAWYGGNETGNAIADIVFGDTNPSGKLPL
SFPLKNEDNPAFLNYKSERNRAIYGEDVYIGYRFYEKTNKQVAFPFGHGLSYSTFEISDL
IVDDNGVDILVSASVTNTGSIDGAQVVQVYVSQHNPSINRPRKELKGFAKVAVKAGETVQ
SIIVIPKKYAASFWDEERNAWVQERDTFDVLVGDSSANTPLKGHFKVPETSWWRGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	38	251	2e-67	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.12e-77	71	819	121	757	beta-glucosidase BglX.
224389	BglX	3.83e-72	41	345	57	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	8.73e-54	320	712	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.56e-44	3	789	46	747	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.69e-43	41	285	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR64317.1|GH3	0.0	10	836	8	836
SMR61167.1|GH3	0.0	10	836	8	836
SMQ55981.1|GH3	0.0	10	836	8	836
SMY29662.1|GH3	0.0	10	836	8	836
UJO24157.1|GH3	0.0	10	836	6	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.06e-279	8	836	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.92e-274	8	836	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.58e-141	11	830	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.81e-119	16	816	9	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.50e-106	12	829	4	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DFA8|BGLI_NEOFI	0.0	11	836	5	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	0.0	11	836	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	0.0	11	836	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	0.0	8	836	2	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.21e-318	10	836	4	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999627	0.000413

TMHMM  Annotations     

There is no transmembrane helices in PV10_07017-t45_1-p1.