CAZyme Information: PV10_06756-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_06756-t45_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	KN847523|CGC13	85676.25	4.1564

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847523:4790946-4793421(+)

Full Sequence      

MLSTSLIASLLATATFITSSTSSPILETRLARRTFTTPQLVSYWGNGFDQIRLGDFCKNT
TLDVIPIGFVNTFPDELGSNGQPKRYPGTNYANACGAPYWVAPDGTQTTMFTTCWQIEED
IPKCQALGKKIVASLGGDSPGNFIASKQSAIDFAQFLWGSFGPLQDPTQTLFPRPFGTGV
VVDGFDLDIESFGQGGFGYADLVNELRRLAALSNKPIIVSAAPQCIVPDVHLADAITNSV
IDYVWVQYYNTEQCSARSLFGSGSLNTNTDVTFGWASWLKQNSKNPNVKLFLGLPASPAA
ASPGYYLNLQEATSLIEEFGCNTRYQDIFGGVMLWEATESARNIQANGLTFADNIKAALG
KLSCAPVHTTTTTTTTTTTTTTTTTTTTTTTTTPPTTTTTTTIPTTTTTTTTTTTIPTTT
TTTTTTTPTTTSTTTTTTTTTTTPPTTTTPTTTEPTTTTTTTHAVGPIDTTTTTTTTTEA
PASTTTTTHDFPHPPVTTTTTTTTTTTSRTVGPIDESTTTTTHVLPTTSSTHPPLPDSSS
TTTSPHVGPVTTSSEPLEPWEDWETTTTRPVDPIETTTTDDYNWSDWPSATTSNTAGPIE
TSTSSLDPWSDWVATTTSTKPVEPVPTSTSVDPWEDWATTTSSKPVDPIQTSTDDYPWWD
WESTSSIIDPVPTSTETSYPWIDWEVTTTSSIPVAPTETSTTADSTYPWLDWESSSVNVV
ATTETVVPVVPIAASTRVAPASDTPAPKPVSPTSATDVRPAIATFTGGATQMKLPTFVTG
AAGCVHERGTGSARRTLVVDRSEGQ

Enzyme Prediction     

EC	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	40	344	2.6e-20	0.6959459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	1.08e-90	38	357	1	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	2.69e-16	39	297	1	223	Glycosyl hydrolases family 18.
119363	GH18_CTS3_chitinase	2.92e-07	110	336	57	252	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
119349	GH18_chitinase-like	3.39e-05	123	250	59	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119359	GH18_EndoS-like	2.86e-04	116	251	52	178	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO61685.1|GH18	5.57e-80	40	366	31	340
EAL85930.1|GH18	5.79e-79	40	366	31	340
BCS11270.1|GH18	4.05e-75	43	366	33	343
BCR90928.1|GH18	1.24e-74	43	366	33	344
CAK40432.1|GH18	1.28e-74	43	366	33	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XVN_A	1.62e-86	40	359	3	307	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
4TX6_A	1.68e-86	40	359	4	308	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XTK_A	1.68e-86	40	359	4	308	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2UY2_A	2.12e-47	43	363	11	291	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
6IDN_A	3.94e-30	39	335	2	256	Crystal structure of ICChI chitinase from ipomoea carnea [Ipomoea carnea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q873Y0|CHIA1_ASPFM	9.89e-81	40	366	31	340	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1
sp|Q4WEP7|CHIA1_ASPFU	1.03e-79	40	366	31	340	Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiA1 PE=3 SV=1
sp|A2QUQ2|CHIA1_ASPNC	2.28e-75	43	366	33	343	Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ctcA PE=2 SV=1
sp|P54197|CHI2_COCP7	9.84e-72	30	366	21	342	Endochitinase 2 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS2 PE=3 SV=2
sp|Q1EAR5|CHI2_COCIM	1.71e-71	30	366	21	342	Endochitinase 2 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.484243	0.515735	CS pos: 33-34. Pr: 0.1948

TMHMM  Annotations     

There is no transmembrane helices in PV10_06756-t45_1-p1.