CAZyme Information: PV10_06333-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_06333-t45_1-p1
• CAZy Family: GT91
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		34054.79	3.9967

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847523:3432036-3433121(-)

Full Sequence      

MHPSFRTLGGLALAVATVNAQLQGFNYGATFEDGTCRMVSDYEGAFNTARNLVGTDGGFT
AARLYTTVQCDTVNTPTSAIQAAINTNTTLLLGMWASAGDGIFEDELAALTNAVNQYGTA
FTDRVVGISVGSEDLYRSSPQGVAGEAGIGVDSATIVRYIDRVRDLIDRTPLLQDIPVGH
VDTWTAWVLPENAIVAERVDWLGHNSFPYFEATLANPIEEADAIFYRALAATEGVSGGKP
VLVTETGWPHIGEDMNLAVASLENARTYWAGVGCDLFGNRDTFWYTLTDANTGQTDISFG
VAGPGNPPSTTPVFDLSCEA

Enzyme Prediction     

No EC number prediction in PV10_06333-t45_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.35e-25	24	278	47	271	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	3.62e-05	24	268	2	252	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD07209.1|GH17	7.07e-118	11	318	9	310
CBX92291.1|GH17	3.09e-114	11	318	9	310
EAL86311.1|GH17	1.29e-104	5	320	3	312
QQK48355.1|GH17	2.47e-104	11	320	9	311
BAE54624.1|GH17	1.74e-103	12	319	10	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.34e-19	24	303	39	283	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.89e-18	24	303	39	283	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DJ47|EGLC_NEOFI	4.57e-106	5	320	3	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	2.30e-105	5	320	3	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	2.60e-105	5	320	3	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	3.08e-104	12	319	10	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q5AUT0|EGLC_EMENI	9.52e-101	11	320	10	313	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000299	0.999675	CS pos: 20-21. Pr: 0.9732

TMHMM  Annotations     

There is no transmembrane helices in PV10_06333-t45_1-p1.