CAZyme Information: PV10_06185-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_06185-t45_1-p1
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	KN847523|CGC6	38490.98	7.1408

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847523:2973909-2974925(-)

Full Sequence      

MSYKSTLATGHFPKKIWQTWKVDPLGFEARDLTTAKTWTAKNPDYRYEVLTDQNDLHYVE
THFGPSGFNRVDIVRVYRSLQLKIIKADLLRYLVMYVEGGVYTDIDVEALKPIPRFIPDR
YDERSLDMVIGIEIDQPEFNNHSILGKKSQSFCQWTFMSKPRLPVMMMLINDIVKWLNSV
ARQQKVPISEIQLGFDEVISGTGPSAFTKAILDHMSMKAERPVTWLDNFHNLGESKLVGD
VLVLTVEAFAAGQGHSDSGNHNAKTALVKHHYHASGWPAMHPRYNHPVYGEVEKCNWDAE
CVRQWDANKAAFDALPPDEQIKQIAMKGNSDANKKLGL

Enzyme Prediction     

No EC number prediction in PV10_06185-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	33	118	4.2e-19	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.32e-25	12	269	82	339	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	9.79e-13	30	119	3	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX62098.1|GT32	6.16e-180	1	332	44	374
QMW40889.1|GT32	1.28e-175	1	332	40	370
BAE58544.1|GT32	1.28e-175	1	332	40	370
UDD56882.1|GT32	1.28e-175	1	332	40	370
QMW28814.1|GT32	5.19e-175	1	332	40	370

PDB Hits     

PV10_06185-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	6.91e-39	13	277	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	8.30e-32	12	280	99	383	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.45e-25	12	249	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.50e-23	13	191	97	300	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	7.32e-06	13	107	58	143	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV10_06185-t45_1-p1.