CAZyme Information: PV10_06059-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_06059-t45_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800	KN847523|CGC11	90007.26	5.1204

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847523:2530770-2533172(+)

Full Sequence      

MSPSSRGTMSLTTLITTLLSLTLLSLHPTSAAADSSSNDTFLWGPYRPNVYFGVKPRLHK
SLTTGLLWANVDNYAAAQNNFRYTCEQNEGMAGYGWEEYDARNGGRQVIHDTGNQIDLTI
DFIKFPGGQNGGSWGARIKGVPREDASPSIVTTLVFYASMEGLGELGFSSEEPDSDGVVT
MHGSTVELGDFDLTFTDPKENSLPYKTHPSWDSKPLDRPLMSSMNIPAEAMWQAKNVLFA
NMKRGIDAYVQEYGQENMPPPWQSFTIAQNPGPGNFHMVQKIYVGAFEFDVLFNSASGPK
VTSESQTKAIAETKTAFKSKFNKIFAPLAPFTKSKFTALSESLFSNLFGGIGYFYGDSLV
DRSYAAEYDEDNEGFWEEAAEARSRAQIQPDEPAELFTSVPSRPFFPRGFLWDEGFHLIP
IVEWDIDITLEIVKSWFRLMDADGWIAREQILGPEARSKVPPEFQVQYPHYANPPTLFLI
IDTLIDKLNSGSLSATEAAHVRTDLQTLYPLLKRQYHWFRKTQFGDIKSYDREAFSSKEA
YRWRGRTPQHILTSGLDDYPRAQPPHPGELHTDLISWVGLMASTLSRLAPLVPEAEDDVA
DFTSQHKAIIRNIDDLHWSATEKMYCDATIDDYEDSIHVCHKGYISLFPFMTGLLPPTHP
NLPHILSLISSPTELWSPYGIRSLAKSDPLYGTAENYWRSPIWVNMNYLILKNLLALAQS
NDTPKAVKTQATSIYVELRRNLVDNVYRQWEQTGFAWEQYNPESGAGQRTQHFTGWTSLV
VVIMRMPDLSANVGIKHGEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	570	785	5.1e-30	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	302	786	2	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	3.18e-113	42	260	2	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	3.02e-06	446	715	304	549	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM12625.1|GH63	0.0	36	791	43	808
QKX57094.1|GH63	0.0	36	800	467	1253
AAR23808.1|GH63	0.0	36	800	40	822
QRD84190.1|GH63	0.0	33	800	32	817
UDD57712.1|GH63	0.0	33	800	32	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	6.16e-162	37	784	11	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.06e-130	24	784	15	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	8.11e-222	34	784	35	804	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	5.96e-161	37	784	41	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	4.71e-132	24	784	70	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	2.25e-128	24	784	70	830	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	1.00e-126	28	784	78	833	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000315	0.999651	CS pos: 33-34. Pr: 0.5375

TMHMM  Annotations     

There is no transmembrane helices in PV10_06059-t45_1-p1.