CAZyme Information: PV10_05609-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_05609-t45_1-p1
• CAZy Family: GH64
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		40348.90	9.1443

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847523:1076396-1077457(-)

Full Sequence      

MRRSLLIFLLVAILLLTFILNSLSTLLSLLVEDASADAIHRSELPAPNSTLIDTRPLLIP
KIIHQTYKNETIPERWRAAQQSCIDLHPDYEYKMWTDATSLDFIQQEYPWFIPTFVGYKH
NIQRADAIRYFVLAHYGGVYIDLDDGCLRRLDPLLSYHAFLRRTIPTGISNDAMGAVPQH
PFFLRVIESLQAADRSWVLPYITIMASTGPLFLSVMWKKWMGEHSHMDPGTWVGRVRVLM
PSEYNNYPWSFFQKFKGDSWHGKDAKLIFWMGKNWFLLVLVGTVIVLTVGFLCYCVYSRL
VAVAARRRNGGVSLAPSPRINALKGSVASRIPLWGLWSGNKGSSYELIEQHDA

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	74	156	4.6e-23	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.78e-71	59	275	82	295	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.62e-26	73	161	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA57874.1|GT32	3.51e-147	1	352	1	355
AAP47108.1|GT32	3.51e-147	1	352	1	355
QMW44769.1|GT32	1.11e-146	1	308	1	303
BAE61832.1|GT32	1.11e-146	1	308	1	303
QRD84258.1|GT32	1.11e-146	1	308	1	303

PDB Hits     

PV10_05609-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	7.68e-96	1	268	1	267	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	5.95e-94	26	268	26	259	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	5.96e-82	37	282	56	303	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	5.31e-77	48	318	46	309	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	8.18e-60	59	317	64	312	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.532530	0.467461

TMHMM  Annotations     

Start	End
5	27
275	297