CAZyme Information: PV10_05381-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_05381-t45_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		40564.31	6.1111

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847523:329891-331019(+)

Full Sequence      

MVLSSPIRRALVVAILLLALFFLLKSSVSESTAEPSYPLSDESSKRPYPPPRAPKKDAVD
QATLQDVASRSLRERLKYHFTYDMEGKFPAYIWQTWKVGPDSGDFEGRLRPFEASWSELH
PLFVHELVTDAAAVHLISYLFASVPEVIEAYEAMPLPVLKADFFRYLILLARGGIYSDID
TKALQSATDWLPQSLDQASVGLVVGIEADPDRADWADWYARRIQFCQWTIQAKPGHPVLR
DIVATITEDTLKMKRSGKLRKGKAPEKGIMEFTGPGVWTDAIFSYFNNKDYFDFTSRRSN
VSYSDFFGIKEHKLVGDVVVLPITSFSPGVGQMGAEGADHPMAFVKHEFDGSWKPENERM

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	114	193	8.7e-20	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.77e-41	71	354	65	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.48e-18	115	194	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA11100.1|GT32	1.94e-150	25	359	26	356
QHY93508.1|GT32	4.95e-150	8	359	5	386
QKX63547.1|GT32	9.35e-150	61	359	66	362
ATZ52760.1|GT32	3.65e-149	8	359	5	372
CCD51914.1|GT32	3.65e-149	8	359	5	372

PDB Hits     

PV10_05381-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.17e-93	71	354	82	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	6.84e-81	78	354	132	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	2.90e-75	71	359	79	475	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	8.22e-73	65	354	107	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.444849	0.555140	CS pos: 30-31. Pr: 0.4615

TMHMM  Annotations     

Start	End
7	24