CAZyme Information: PV10_05279-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_05279-t45_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
724		79265.42	4.5489

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847522:5081096-5083706(+)

Full Sequence      

MLSYPHLIVLLACSAVQNALAASRSYELTLSTGIRSPDGFAREVYLINNQQPGPLIEAEE
GDDLEIFVQNDLPVETTIHWHGLLQRGTPDMDGVPGVTQFPIPPGGNFTYRFSTADEYGF
YWYHSHFRAYYNDALRGPLLIHPSPSRPRPFKTLAQSSSEFDMMLQVERSGTILLLSDWY
HRLSDRIYDEYFTTGAFPQCVDSLLANGRGRVQCLPQNILEAGPGLGLESNIANDPHDPD
AMSMAMESSTTSGMGMASMSMDTASMPALTTDAMSMSMRKRSDHTASPSTGTAMSDMSAM
SSTLTSMATMGSSTASVGTEDQTMSTTVDMPQMTLGPRGCSPPMMFRPGFNASSLPLETC
TNTTSELFTFTADASRGWTALHLVNAGAVSRLSVSLDGHSMFVYEADGLYVTLQEVQVLH
ISIGQRYSVMIRLDQNPGDYSFRFAAYPYGDMQQVIEGQAILSYQNMTNNTNMTMMSRMV
SPWMLVNGSATSGTVELDDQTLAPFMGNTAPSGAANVTRHFAINQTDIVTWVANREPFVE
PARPIIYGSVSDGWNATTTLLTPANATVDIIMKVANDSMDTMGHPMHLHGHKFWFLGSGE
GDFPFESVTDAPSSMINLQNPPYRDTIDLPPSGWAVIRYITDNPGAWLFHCHVQWHLVSG
MAVVLVENEERMMDMVGSIQNAFNNPATNNSQAEGTSAASTLSGNCPRQYLSFLFSLLLL
FVLL

Enzyme Prediction     

No EC number prediction in PV10_05279-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	40	221	4.6e-53	0.44692737430167595
AA1	369	662	4.3e-41	0.5195530726256983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	5.08e-67	24	679	2	531	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
259919	CuRO_1_Abr2_like	3.95e-64	26	142	1	117	The first cupredoxin domain of a group of fungal Laccases similar to Abr2 from Aspergillus fumigatus. Abr2 is involved in conidial pigment biosynthesis in Aspergillus fumigatus. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. Laccase has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism in fungi and plants. Like other related multicopper oxidases (MCOs), laccase is composed of three cupredoxin domains that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 1 of 3-domain MCOs contains part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
177843	PLN02191	1.17e-59	8	672	8	551	L-ascorbate oxidase
259926	CuRO_1_Diphenol_Ox	4.98e-57	24	142	1	119	The first cupredoxin domain of fungal laccase, diphenol oxidase. Diphenol oxidase belongs to the laccase family. It catalyzes the initial steps in melanin biosynthesis from diphenols. Melanin is one of the virulence factors of infectious fungi. In the pathogenesis of C. neoformans, melanin pigments have been shown to protect the fungal cells from oxidative and microbicidal activities of host defense systems. Laccase is a blue multicopper oxidase (MCO) which catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism. Although MCOs have diverse functions, majority of them have three cupredoxin domain repeats that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 1 of 3-domain MCOs contains part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
215324	PLN02604	3.81e-55	7	679	8	558	oxidoreductase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOD95012.1|AA1	5.11e-259	1	696	1	662
QLI72976.1|AA1	2.91e-255	19	678	27	657
QPG98040.1|AA1	1.98e-254	3	689	5	658
UPL00042.1|AA1	8.57e-248	21	638	17	601
ATY66532.1|AA1	4.48e-233	16	677	12	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JHU_A	7.28e-45	27	668	7	467	T2-depleted laccase from Coriolopsis caperata soaked with CuCl [Coriolopsis caperata],4JHV_A T2-depleted laccase from Coriolopsis caperata [Coriolopsis caperata]
6H5Y_A	4.71e-44	27	668	7	467	PM1 mutant, 7D5 [Aspergillus oryzae],6H5Y_B PM1 mutant, 7D5 [Aspergillus oryzae]
3KW7_A	5.23e-44	27	668	7	473	Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2],3KW7_B Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2]
2HRG_A	3.03e-43	27	668	7	467	Crystal Structure of Blue Laccase from Trametes trogii complexed with p-methylbenzoate [Coriolopsis trogii],2HRH_A Crystal Structure of Blue Laccase from Trametes trogii [Coriolopsis trogii]
5A7E_A	1.05e-42	27	668	7	467	Chain A, CORIOLOPSIS GALLICA LACCASE [Coriolopsis gallica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W3X732|PFMAY_PESFW	4.89e-84	24	672	23	567	Laccase PFICI_06862 OS=Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) OX=1229662 GN=PFICI_06862 PE=3 SV=1
sp|E9RBR0|ABR2_ASPFU	7.27e-77	10	667	8	571	Laccase abr2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=abr2 PE=1 SV=1
sp|A0A1S7IUL2|MCE_TALPI	7.83e-72	27	671	27	584	Multicopper oxidase MCE OS=Talaromyces pinophilus OX=128442 GN=MCE PE=1 SV=1
sp|A0A0B4HQH6|MLAC1_METMF	9.67e-69	4	667	4	598	Laccase 1 OS=Metarhizium majus (strain ARSEF 297) OX=1276143 GN=Mlac1 PE=3 SV=1
sp|A0A0B4GLB5|MLAC1_METGA	1.29e-67	36	667	35	597	Laccase 1 OS=Metarhizium guizhouense (strain ARSEF 977) OX=1276136 GN=Mlac1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000243	0.999720	CS pos: 21-22. Pr: 0.9718

TMHMM  Annotations     

There is no transmembrane helices in PV10_05279-t45_1-p1.