CAZyme Information: PV10_05017-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_05017-t45_1-p1
• CAZy Family: GH38
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424		47036.50	5.9121

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847522:4206699-4208051(+)

Full Sequence      

MKFQSIRRPSEAMLPRQFHRLLPVLVVGFVFFLYHRAIAGPGDSTPSQTEKFPRKIWQSW
KVSPLSFETRDMERALTWTTKNPYHRYEVLTDENALGYVEQYFGPSGFNRPDVVFTYKSL
KDKIIKADLLRYLIMYAEGGLYADIDVEALKPIAAWIPDRFNERDIDIVVGIETDEPSFI
GHPILGKKAQSFVQWTFLCKPRLPVMMRLIDGILNWLNRIAKEQGKPISEIELDFDEVLS
GTGPSAFTSAVLAEISAVTGEQPTWTPFHNMFEAKLAGRTLVLTVEAFAAGTGHSDSGNH
GSKNALIKHHFHASSWPTSHPRHKHPLYGEVERCNWNTECVKLWDSNTAFFDKLPTQEQL
KLIAMKELEEEEQAFVDAEAEAAAGAAAEDNVIPPGDVGGAAAAAAAAAADAVAAAQAPI
GGRA

Enzyme Prediction     

No EC number prediction in PV10_05017-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	158	1.1e-18	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.82e-21	50	206	80	228	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.26e-13	77	159	10	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO17754.1|GT32	2.20e-164	1	366	8	374
CAK96510.1|GT32	1.27e-161	10	367	20	382
QMW40889.1|GT32	7.82e-161	10	366	2	365
QMW28814.1|GT32	7.82e-161	10	366	2	365
BAE58544.1|GT32	7.82e-161	10	366	2	365

PDB Hits     

PV10_05017-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.37e-30	53	316	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	2.78e-27	51	288	129	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	1.15e-26	48	316	95	375	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.67e-20	53	237	97	307	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.949740	0.050275

TMHMM  Annotations     

Start	End
21	38