CAZyme Information: PV10_04832-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_04832-t45_1-p1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252		26433.20	4.0569

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847522:3632938-3633769(+)

Full Sequence      

MGRFATLSTVCLAATTTISASPLPSLKQRQDDCSAVHIFIAKGWNETYPGRQGKLTGAIC
YGLDSCSYEDVLFSNTPEDDYCGSVTEGAINGVAQVTAYAERCPQSQLVVSGYSQGANVA
GDILGGGGGPFGTPPLNCSVGYTDGLDPTTSPGNQIGAVLLFGDNRHVANQSYNVLSGAS
AAAENPRPEPQLERLNAFASVMRSYCDIADPVCAAVGGSDPDVETHLNYFDLYSDDAAGW
VKWILENPPSTE

Enzyme Prediction     

No EC number prediction in PV10_04832-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	33	242	2.2e-31	0.9735449735449735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	3.06e-18	33	242	2	170	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL04270.1|CE5	4.49e-81	29	242	21	227
QGI65106.1|CE5	3.74e-80	8	242	5	226
CCT69066.1|CE5	3.74e-80	8	242	5	226
QGI95990.1|CE5	3.74e-80	8	242	5	226
QGI82360.1|CE5	3.74e-80	8	242	5	226

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QOZ_A	1.92e-15	33	242	2	203	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
1BS9_A	3.55e-14	33	242	2	203	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	3.55e-14	33	242	2	203	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	3.39e-13	33	242	2	203	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99034|AXE1_HYPJE	1.37e-14	9	242	9	234	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|O59893|AXE2_TALPU	4.05e-14	19	242	16	230	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	7.58e-13	8	251	4	238	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|B9U443|CUTI1_COPCI	4.35e-09	3	119	2	121	Cutinase CUT1 OS=Coprinopsis cinerea OX=5346 GN=CUT1 PE=1 SV=1
sp|A6WFI5|CUTI_KINRD	7.36e-06	33	229	36	201	Cutinase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=cut PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000375	0.999606	CS pos: 29-30. Pr: 0.8493

TMHMM  Annotations     

There is no transmembrane helices in PV10_04832-t45_1-p1.