CAZyme Information: PV10_04529-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_04529-t45_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574	KN847522|CGC21	63205.28	6.1278

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847522:2629328-2631052(+)

Full Sequence      

MRTAILWSHFLVLLAHLGPTCADDTPQEPALVVNRHDGQRDRFGLCPDYTNYAHHIHKPL
SKGPLQLPFQRPHPQCRLFSSPAVEKVIEDLFPSFKDPDLAQIFRNAFPNTLDTTVLWHV
DGVESHAQSTHSVPTRAQWSGAQSFIVTGDINAEWLRDSTNQLAQYQPLAKSAPEISRLL
LGAINTQAEFVIASPYCNAFQPPDPSHLTPVPTGQEDIVHPAYEPSVVFECKYELDSLAN
FLSLSNQYHNSTGSLEFITPRWYTALNAVLHVLNAQSQPTFNPGTGLYQRNEYTFSRSTR
AGTETLNLDGIGNPLAAGTGLIRSAFRPSDDATTFGFLIPANAFMSVELARTANVLRAAA
KDSKTTASDAEMINQVAADLDQRSEAIKAGIYEHAVIKHSKYGDVFAYEVDGYGSHLLMD
DANVPSLLSLPMLGFVDASSEIYQNTRRMILSRSNPYYLSGKKFSGIGGPHIGLRNAWPM
SVLIQAVTSTDDDEIMDCLNRVRDVSVLGLINESVDVIRGVKPGGDGMTRSWFAWANSVF
AQTILSLIEKKPSLILNTDEAGKRKYVLGQGWTG

Enzyme Prediction     

No EC number prediction in PV10_04529-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	97	545	6.9e-155	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	97	545	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.84e-153	76	554	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA12840.1|GH125	9.53e-227	10	555	9	534
QSZ28718.1|GH125	3.49e-224	1	559	6	537
QRC97037.1|GH125	2.15e-223	46	568	45	547
QVM13217.1|GH125	2.39e-223	25	559	21	539
CAE7200768.1|GH125	4.98e-222	46	568	45	547

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	9.78e-90	71	558	43	479	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	1.23e-89	71	558	23	459	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	2.58e-89	71	558	21	461	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	9.49e-75	84	551	12	426	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	1.50e-74	84	551	12	426	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.32e-164	46	555	27	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000186	0.999798	CS pos: 22-23. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in PV10_04529-t45_1-p1.