CAZyme Information: PV10_03889-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_03889-t45_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	KN847522|CGC19	43194.62	5.0091

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847522:651343-652568(+)

Full Sequence      

MHARFSVTGFLLTLILFVYSRNIPFLVGQATADRSRCLSSGQVGQDGTWRAATEKSSSES
TAHQQVLNATVGFEKVYTISLPERSDRRDAFTLQARLSNISFEFRDGVLGSDISPKALPL
TFDQDEGTKGCWRAHLNVFQEMVRKNVQSALIFEDDADWDVAFRHQMVLAADAVSFVTTS
PPGRESPYGNDWDILSLGHCAAVPQQDTENYFVIPKDPTVLPPDARLEWEKPDMGPWEEG
ELGDTQTRLYFRTAWLSCLTAYAVSLRGAQKILYRQSMVPWNEPVDNGIGTMCKNGELNM
SCISAFPTLVGISKPAGSANRGSDIRDQDNVYIHEQGWSEMVLYSIRQNVPRLLTGLKTF
VATHSPAPEKTMGELTSAVGHGEYLVDNV

Enzyme Prediction     

No EC number prediction in PV10_03889-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	73	287	4.3e-29	0.9834254143646409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	2.78e-25	75	160	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	1.23e-13	73	286	1	197	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
225843	COG3306	1.27e-08	72	286	1	184	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK45731.1|GT25	6.17e-61	64	384	54	377
USW54837.1|GT25	6.36e-59	52	385	31	383
CAP98036.1|GT25	2.18e-58	46	385	31	381
BCS10899.1|GT25	2.19e-58	55	364	43	351
BCR98565.1|GT25	6.33e-58	55	364	85	393

PDB Hits     

PV10_03889-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8K297|GT251_MOUSE	4.70e-07	71	292	333	523	Procollagen galactosyltransferase 1 OS=Mus musculus OX=10090 GN=Colgalt1 PE=1 SV=2
sp|A5PK45|GT251_BOVIN	4.72e-07	71	198	339	469	Procollagen galactosyltransferase 1 OS=Bos taurus OX=9913 GN=COLGALT1 PE=2 SV=1
sp|Q8NBJ5|GT251_HUMAN	6.25e-07	71	198	338	468	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1
sp|Q5T4B2|GT253_HUMAN	1.07e-06	71	208	317	457	Inactive glycosyltransferase 25 family member 3 OS=Homo sapiens OX=9606 GN=CERCAM PE=1 SV=1
sp|A5PMF6|GT251_DANRE	1.43e-06	71	307	320	524	Procollagen galactosyltransferase 1 OS=Danio rerio OX=7955 GN=colgalt1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.480725	0.519284	CS pos: 20-21. Pr: 0.4513

TMHMM  Annotations     

There is no transmembrane helices in PV10_03889-t45_1-p1.