CAZyme Information: PV10_03537-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_03537-t45_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	KN847521|CGC3	42696.70	4.1290

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847521:5047888-5049119(+)

Full Sequence      

MYLLSVVLAAQLSAVLAAPWCEDGDGRKLWNASGFKSLVTFGDSLTDGGRAEAMILNEGQ
PLEPGTVIPHSNNTPNGGRSWTSYVTQYVAESGTGSLELYNYAISGAVCSSNIVNIQFPG
LDFTMPGVLDFEIPTFEADIKATIPGTNDPFFDPPLDRDSAVYSIWIGHNDLGNNGFLEA
KQTPGHTVTDYINCVYESLDALYKLGGRFFVIGSLLPLELTPLYANETLNGLESPDLWPE
KSELDSTVVANNILSLTNTVNTVFKYQTPYELKIANRYPGAHFAVFDGNSVIRDIYQNPD
DFFNGTAPPNIQVPAAECTFDDFGMTVCEPTGDAIGNLDGFMWFDNVHATEQTHRVLARE
FVKVLDGESTYTQYYKSPSRRSYWGLLAC

Enzyme Prediction     

No EC number prediction in PV10_03537-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	38	361	3.5e-52	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	3.94e-40	37	362	1	268	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
225780	COG3240	2.62e-11	8	358	6	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238875	SGNH_plant_lipase_like	2.14e-10	160	361	129	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	3.13e-10	38	361	1	224	GDSL-like Lipase/Acylhydrolase.
238883	Triacylglycerol_lipase_like	3.38e-04	35	365	1	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX58204.1|CE16	2.72e-82	30	375	21	348
USW54667.1|CE16	9.10e-82	18	375	27	366
QGA14322.1|CE16	5.68e-81	6	375	12	357
QSS54699.1|CE16	1.45e-79	24	376	18	351
BCS15697.1|CE16	3.27e-79	12	375	7	354

PDB Hits     

PV10_03537-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	1.02e-58	35	376	27	346	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999752	CS pos: 17-18. Pr: 0.9776

TMHMM  Annotations     

There is no transmembrane helices in PV10_03537-t45_1-p1.