CAZyme Information: PV10_03366-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_03366-t45_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
819	KN847521|CGC5	92055.45	9.7565

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847521:4466795-4469324(-)

Full Sequence      

MLSIFLFVAICLYAIPAWSQDVARPSNTSLQWGPYRPNVYFGVRPRIPDSLLMGLMWSNA
DQASYNGIAKNFRHSCDQDDGAVRYEWIQYDARKGGIQVMNDTANHLDLITQFAKGPEAQ
APGSWGLKVHGFKRPGARRRQKTTLVFYIAGENKASKIKCKNTGREGIICKGRTPGVGKF
TIRLPAASVISTTSRKVSVYSMKVAIDSVWQAKTIFLKSLKKNKAGGGMISNRPGLGNLH
FIQLMLDGDFAFDLTFTSGKDPDMINPNSLIGAVADARYTFQSRFESTFSPATPFTNIEH
VHFSQSLLSNLLGSLGYFDGTFTVNTEEASSNKQDATPKYWNDALAKFSEARIEERGPHT
LFSAVPSRTAFARGFLFDEGFHLLTILDWDLDMGVEMITSWLNLIDERGWIPREMILGKE
GRNRVPPELQTQNPHLSAPPTMFLAIQSLLDKLKGTVPYDGMPSRHHLSRDLGKAYLKSI
YPKLKLHYSWFRQINAGHPGQPAMPASLSPETYRWQFRTREFAISSGLADYPRLEPPSTD
ELHVDALAWVGLMARTLESVATYLSDAEGQEIFSKQSSDILQSLDKIHWSEKQQMYCDTK
MSVGRNGYGGEKEIEHICHRGYVSIMPFLLGLLPAKHPHLGAVLDMMRQPSELWTSHGLR
SLSPRDSYYSKGTNIYRGPIWVHFNYLAIKQLLTVAQESGPRQKRARDMYAALRVGLVDS
VYRTYAESGWLWEQYHPDTAKGMRARGFVGWNSLLVKIMAMPDLRSASASRVDALDYASL
PGTGDDSHLFPLIAISTLFLATYVNRRKVLVLLHRLLRK

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	539	759	4.2e-18	0.43508771929824563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	9.34e-148	281	761	17	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	8.48e-71	30	223	1	206	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	0.002	624	727	486	563	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2799082.1|GH63	4.97e-213	5	766	3	767
KAF1937561.1|GH63	7.41e-211	19	777	21	783
QVM12625.1|GH63	3.22e-209	16	772	34	814
KAF2117832.1|GH63	7.32e-209	19	764	22	778
KAF1849764.1|GH63	8.04e-209	21	808	29	824

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	6.94e-126	20	759	5	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.51e-99	9	760	14	776	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	1.50e-156	20	760	32	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	6.23e-125	20	759	35	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	1.78e-99	9	760	69	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	2.75e-96	14	760	77	834	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|O88941|MOGS_RAT	9.74e-95	32	760	94	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999786	CS pos: 19-20. Pr: 0.9767

TMHMM  Annotations     

There is no transmembrane helices in PV10_03366-t45_1-p1.