CAZyme Information: PV10_03197-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_03197-t45_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		88500.76	9.1019

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847521:3916860-3919291(-)

Full Sequence      

MSTPNSSLRQRPGKEKSKGLANGSKSSDEFLDIKYRQIQEEQAPKDLDYKIALAVITILA
FVTRFIGISHPDEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAFIGWVVGYDGHFL
FDNIGESYIANNVDYVAFRSVPAFLGALTVVVVYMIMWESGYSLPACILASGLILFDNSH
VGQTRLILLDATLVFFMSLSVYSYIRFYKQRHEPFGRKWWKWLLLTGFNMSCVISTKYVG
TFIFVTIGWAVLIDLWDLLNVDRKGGAIDLVTFGKHFAARAVGLIIIPFFFYLFWFQVHF
AVLTRSGPGDDFMTPEFQETLSDNLMHQASIDILYGDNIVLRHKDTKTYLHSHPDKYPLR
YDDGRISSQGQQVTGYPFNDTNNEWQILPNTPLPDETVFGTPVKNGDVVKLRHVVTNTML
LTHDVASPGFPTNQEFTTVSIDDAAARRHNDTLFEIKLEQGKKAAPFKSKSGQFKLIHFP
SKVAMWTHTSPLPEWAFKQAEINGNKNSQQSSNIWYVDDIPSIPADSPRLHKEAKKIKTL
PFLVKYFELQRAMFFHNNALTASHPYASQPFEWPFLLRGVSFWTQESTKQQIYFLGNPIG
YWITSALLAVLAGVLGADQLSLRRGVDALDRRTRSRLYNSTGFFFICWAAHYFPFYLMGR
QLFLHHYLPAHLASCLVTGALVEFIFSVDPQLDEETAASINAKKDKAASKLPEKARRAFH
KGKGSLLGTWIATIVILSVVLYGFYFFSPLTYGWPGLTPQQVNARKWLFYELHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	55	300	5.7e-71	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	43	768	17	690	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
406576	PMT_4TMC	2.17e-79	545	768	2	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
396786	PMT	1.55e-78	54	304	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
397103	MIR	1.34e-13	340	498	2	164	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	1.17e-09	331	390	2	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA05800.1|GT39	0.0	31	776	34	771
ATZ46851.1|GT39	0.0	31	776	32	769
CCD48541.1|GT39	0.0	31	776	32	769
QRC97974.1|GT39	0.0	1	776	1	771
CBX95750.1|GT39	0.0	8	776	60	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	2.24e-102	47	768	47	724	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	8.05e-93	55	756	70	737	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6ZQQ_A	2.95e-08	350	516	34	198	Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_B Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_C Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_D Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	1.01e-245	8	776	5	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	1.57e-237	49	768	58	767	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	2.09e-228	49	776	52	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q99PR0|POMT1_RAT	6.34e-109	47	767	35	736	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1
sp|Q8R2R1|POMT1_MOUSE	3.33e-108	47	767	35	736	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999904	0.000110

TMHMM  Annotations     

Start	End
51	68
93	115
136	158
186	208
231	253
277	296
593	615
635	657
724	746