CAZyme Information: PV10_03114-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_03114-t45_1-p1
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
495	KN847521|CGC20	54199.94	4.3690

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847521:3667289-3668837(-)

Full Sequence      

MLLVFLACVFCWVALSPHLVSAQSKTLKDCIVKALDGRSNRVAFSDKFLFELLDVNRYNL
VYKTKPLAITYPESAQEVSGVVKCAAEADAFVQARSGGHSFGNYGLGGDDGAVVVDMKYL
DQLTFDESDKTAHLGPGNRLKDVNEFLLEYDRVVPHGDAPQVGVGGHYTIGGLGRISRQY
GAATDQIIDAEVVLANGSIVTASEKENEDIFFAIRGAGASFGIVTDFHVQTHPAPGNAVA
YTYNVTIGDPKLQAEAFKAWQELVTDPDLSWKLSSQFIAFPFGSVITGFYYGTEKEFSAL
KLETQLSGINESSIDVHLVDAAVAVGHDLSELGLELFAGIPTHFYSKSLSFTNDTLMTDT
GIDAMFEYFGEASRDLSLLGVPWFVIFDLEAGKINEVAPDATAYAFRDTLYFLQSYAVDL
LGIFENQQRDFLDGLNEVVIDHTPGIKGSYPGYVDPFLADAQKQYWGENLARLEDIKAKR
DPDNVFRNPQSVELA

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	57	492	7.5e-78	0.9868995633187773

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	4.45e-35	61	492	27	456	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	2.02e-29	66	203	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	4.00e-14	449	493	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	1.44e-11	1	235	7	242	cytokinin dehydrogenase
178402	PLN02805	1.58e-11	66	376	134	408	D-lactate dehydrogenase [cytochrome]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO23499.1|AA7	3.17e-142	28	495	25	486
CAE7010772.1|AA7	1.15e-139	23	492	9	475
QGA17347.1|AA7	6.55e-138	21	494	3	473
QRD00400.1|AA7	2.49e-137	23	495	6	475
AHG26149.1|AA7	6.29e-135	24	492	3	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	5.78e-65	14	495	17	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3HSU_A	8.53e-58	53	493	30	477	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
1ZR6_A	3.22e-57	53	493	30	477	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3RJ8_A	6.56e-56	54	492	25	469	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
6Y0R_AAA	1.37e-55	54	493	49	489	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	1.31e-92	30	492	10	467	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	2.98e-64	14	495	17	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	1.52e-56	53	493	49	496	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	5.40e-55	54	492	47	491	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|I1S2K2|CHITO_GIBZE	7.06e-55	54	493	49	489	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000191	0.999780	CS pos: 22-23. Pr: 0.9764

TMHMM  Annotations     

There is no transmembrane helices in PV10_03114-t45_1-p1.