CAZyme Information: PV10_03052-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_03052-t45_1-p1
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614	KN847521|CGC23	66804.09	4.1474

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847521:3500273-3502117(+)

Full Sequence      

MYARYLSLTAGACLVSLATAQGTVSLTISARPPEGASDFISPAFAGFGIEPSNLFSFTGG
AEENELSKNLIENLANYTGTPPHMRIGGNTQDYFIWNEDQDEYIWYNNASEAVGQGAYPS
DHMVIGPRYFEVMNRWPSNTPITFGLNLAYSEPDYLDQIVIMAHQVFNRLTNLNVVSLEI
GNEPDLYLENGFRSGEWGGNIYTQQWLNRAEAVWQEVLRPRGIPSNIFEPGTTASTIGTS
FELNDLDSFGITVTANDSSKPYIAAWNQHDYYYYIGVSTYPLTQYHFMTLSTTNDQFAHW
EEQVLQALATPYPYHLREMGVVGPIGLNDITDVFGASLWALNFFLYAATLNISSVQMHMT
DNSNASAWQPIRFYGKDPFVRPNYYAYAAFDQLIGPTCQAQISGSVLTNAPEPYGGRSAV
YQIYQDSTISSIVLINSNEANVSMTDKPSLTFELTLPTEFAGEEVHLAYLTNEGADAKSG
TTWNGISYEESGNGLPTRVNDTQATARVGDDGVLSVLVRDTQAIVVSLSGPVGQLEANPS
ACQALLEKQPNARPAETPVGTNTADGTSTSDSSSHTNAASSATAASPSNGMTRLSTVILG
TLVSALLSGCWLVL

Enzyme Prediction     

No EC number prediction in PV10_03052-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	42	489	1.6e-57	0.9120879120879121

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	7.35e-22	421	525	2	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC87479.1|GH79	1.43e-181	11	545	11	548
CAE7199561.1|GH79	8.28e-177	17	533	18	531
QRC97116.1|GH79	5.78e-172	1	533	1	530
QDS74350.1|GH79	1.43e-171	16	533	18	533
CBX93703.1|GH79	3.19e-168	14	533	312	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	1.68e-17	24	455	3	388	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5G0M_A	1.23e-10	84	409	75	372	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	1.27e-10	84	409	75	372	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]
5L77_A	2.97e-10	84	409	95	392	A glycoside hydrolase mutant with an unreacted activity based probe bound [Acidobacterium capsulatum]
5BWI_A	2.90e-07	19	529	10	446	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	2.12e-38	25	528	34	541	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	1.37e-34	16	506	12	525	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002994	0.996994	CS pos: 20-21. Pr: 0.9573

TMHMM  Annotations     

There is no transmembrane helices in PV10_03052-t45_1-p1.