CAZyme Information: PV10_02979-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_02979-t45_1-p1
• CAZy Family: GH12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
896		101811.70	6.9857

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847521:3326572-3329307(+)

Full Sequence      

MPGTMKPGRVRNRPPRLTIQQGTQYNPQTSSEKSTPTHASVQEQSESLNSSSQAESRPPV
SVNNVKYEVMLLYLRQQQLERRWASDNTAEGVVLKRGKHDFICQPAELPKHTNGFYDEIK
KLNVKVAMTVRTSAIQLFLKEYKLPFVPFSNGQQLHIIENMSTLSFCKRHHYAAFVRSQG
SLVVWDEDPTEVIARAERIEKYLVNMLWTLDSAQDRSFTQIERSKEMIEKSKQVDVQATE
VSSTKSESSTKEEKPRKTRIYQSILVAIVSILTIFCLSIGWREIAKEIAIDHTYTRLAIL
AAAPLQLWLAWFFFTTLVNGISQMIGPVHQVAENSKFYSAVPSERLHNRELPHVTIQCPV
FKEGLEAVIIPTVTSVNKAISTYELQGGTANIFFNDDGMQLISDDDARKRVQFYEDNNIG
WVARPGHAPKGDENGNNVFIRAGKFKKASNMNYCLAISNRIEEIMSEESRTSAWTQEDED
RSYQNAFDQVFAEHKGRAWGGGDIRMGDYILLIDSDTRVPEDCLLDAVSEMEISPHIAII
QFSSSVLNVTQSFFERAITFFTNLVYTAIRYAVANGDVAAFIGHNAILRWSAVQDVRYTD
DSGIEKFWAENTVSEDFDMALRLQSLGYDLRFGTYCGDGFKEGVSLTVYDELSRWEKYAY
GCAELLFNPFRYWPTRGPITPMFRRFITSPMSLMAKITILAYIGTYFAIASAWVLTLMNY
FLVGWFNGYLDHAYVNSFQIYFGIVIVFQALGTVSLAVFRYRVENRSLVGAFFENLTWLL
LLTVYLGGISMHISQAILSYLFSVDMTWGATAKEAKSTSFFREVPIILRRFKFTFAYCII
MITTMIVMAGVGPLGQLVPHDYRITTFTAIFPLGIVVGFHFLLPLVLNPGLMQFTF

Enzyme Prediction     

No EC number prediction in PV10_02979-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	509	723	7.3e-49	0.9695431472081218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	8.52e-45	509	726	1	192	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	6.88e-15	507	817	138	428	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	3.81e-09	507	616	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133034	Glucan_BSP_MdoH	5.02e-07	497	589	90	179	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
225494	MdoH	7.20e-07	497	820	235	556	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO15800.1|GT0	0.0	62	896	69	888
SMY19115.1|GT0	0.0	62	896	65	883
SMQ45410.1|GT0	0.0	62	896	65	883
USW53192.1|GT0	3.22e-317	62	895	68	887
SMR43958.1|GT0	1.15e-315	62	896	65	900

PDB Hits     

PV10_02979-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

PV10_02979-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000001

TMHMM  Annotations     

Start	End
260	282
292	314
701	723
738	760
767	789
793	812
833	855
865	887