CAZyme Information: PV10_02902-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_02902-t45_1-p1
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603		70086.14	6.1770

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847521:3101355-3103233(+)

Full Sequence      

MARIHRYFLVLAIFFTFVLLVGLFFGWNDQVPSYLRDNHFSLGLSRPAPAAPPPPPRLPE
VHPIEYLVSNARDSFSQVTARQSQTLEEAVHEYQRRYGISPPPNFDKWYEFAVSNNVRLI
DEYDTINDLLLPMWAFSPFAIRQKVKKAFGGNDFVLQVSIREGNVAGYYNKGTNWRLKII
RNTIQIFAEWLPDMDMVFNMHDEPRVIIPHDDLARLVKRGREVRKTVGKDESSVSNVWSS
PAKDLIQGFYNTSIIRPFNEYPHQFTWAISRSSCPPDSPARSLDLDGHPADDDTTPYIYP
PLNFVQNHTLMTDICQMPSLENTYGFFNKPNAWSVSHDFLPIFSPSKISSFSDILYPAPW
YLQEMVSIDDAKDLPWEEKADLLYWRGTTTSGFSEQGVWPRQNRQRFMTQAEKPGREHIL
KLDPDRELGWQLEETDRSTLQHLYNTHFTFIGQTSKEDHDAQKKFFDVRKDEDFQNVTLY
KYLLDLDGNAFSGRFHAFLGSHGLAVKMALFREWHNEVIMPWVHYIPLNLYGSDHFEVMR
YLTQESKGQELAAEIARESRAWAHNVLRQVDMQAYIFRLLLEYGRLSDDNRANLGFTLPS
PDS

Enzyme Prediction     

No EC number prediction in PV10_02902-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	317	587	4.8e-71	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.37e-16	341	586	32	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.15e-10	341	586	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT01287.1|GT90	8.33e-181	53	598	88	633
UKZ59411.1|GT90	3.45e-179	53	596	86	628
UKZ54826.1|GT90	6.52e-178	53	598	6	551
UKZ85843.1|GT90	3.05e-177	45	598	63	629
QSS52524.1|GT90	1.21e-176	62	597	80	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	5.60e-10	308	590	85	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.15e-08	308	586	119	378	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	3.67e-49	62	593	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	2.63e-10	308	590	113	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	4.87e-10	308	586	128	388	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	3.39e-09	308	590	113	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q8BYB9|PGLT1_MOUSE	1.05e-08	308	590	113	373	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

Start	End
7	26