CAZyme Information: PV10_02410-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_02410-t45_1-p1
• CAZy Family: AA8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480		51606.86	4.1750

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847521:1479059-1480556(-)

Full Sequence      

MRSAITTTLGAALLLPSLAFAQSSGCGPAPSNGIRPSIASGYTYQVVATGLSRPRGIHID
TEGNLLVVERGKGAVTAHTLEEENGCVSIASSTDVTGDVRLNHGIELSPDGTTLYASNSD
DMFSWTYDPSTRTVSNRNTLITNLTGVGHSTRTLLLSRKTEGMMVVSKGSMENIDILAYD
VSTGSSQVKAFNLTNVTDPYDYNNEGLLMGWGLRNEVGIGEHPESGGIWGIENSADELFR
HGVDIHRNNPAEKINFLGYLDGTEYEYQGANFGYPWCFPVWEVEELPQNENLTVGSQFAI
DSTPEANGQNRTDEYCAETAPPRLSFQAHMAPLDIKFNNSGQEAWIAWHGSWNRDDPVGY
ALSVVSWEQDGEPTDPPDSMTAKTDIFGNEDLSRCPGNCHRPVAMAIDAQGRIYLTSDSS
GEIYLITKLADSDDGGDGDSDSDGDGGSGEPDIAGLPLHGQARLCGLAACLLSVLAFFVW

Enzyme Prediction     

No EC number prediction in PV10_02410-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	30	426	9.2e-156	0.9850374064837906

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	1.42e-22	1	428	14	396	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS74351.1|AA12	7.09e-140	12	428	10	426
UPK97414.1|AA12	4.98e-133	13	428	12	431
QBZ62710.1|AA12	1.54e-132	30	435	35	434
EHA48884.1|AA12	4.37e-132	30	435	35	434
QPC63491.1|AA12	7.78e-130	5	434	7	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1Q_A	1.47e-112	36	426	11	400	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	1.52e-112	36	426	12	401	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	1.57e-112	36	426	13	402	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	1.11e-79	26	428	5	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q44091|SNDH_GLULI	4.02e-12	36	427	72	442	L-sorbosone dehydrogenase OS=Gluconacetobacter liquefaciens OX=89584 PE=4 SV=1
sp|O51055|Y024_BORBU	3.96e-11	38	426	35	374	Uncharacterized protein BB_0024 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0024 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000403	0.999564	CS pos: 21-22. Pr: 0.9743

TMHMM  Annotations     

There is no transmembrane helices in PV10_02410-t45_1-p1.